Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3999006..3999264 | Replicon | chromosome |
| Accession | NZ_CP116411 | ||
| Organism | Escherichia coli strain HH45 | ||
Toxin (Protein)
| Gene name | hokC | Uniprot ID | S1NX00 |
| Locus tag | PL330_RS19075 | Protein ID | WP_000809168.1 |
| Coordinates | 3999112..3999264 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 3999006..3999063 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PL330_RS19050 | 3994312..3995253 | - | 942 | WP_000767329.1 | bifunctional riboflavin kinase/FAD synthetase | - |
| PL330_RS19055 | 3995261..3995479 | - | 219 | WP_001295417.1 | DUF2575 family protein | - |
| PL330_RS19060 | 3995582..3995845 | + | 264 | WP_001274021.1 | 30S ribosomal protein S20 | - |
| PL330_RS19065 | 3996389..3997294 | - | 906 | WP_271710796.1 | transcriptional activator NhaR | - |
| PL330_RS19070 | 3997360..3998526 | - | 1167 | WP_000681360.1 | Na+/H+ antiporter NhaA | - |
| - | 3999006..3999063 | - | 58 | - | - | Antitoxin |
| PL330_RS19075 | 3999112..3999264 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
| PL330_RS19080 | 3999368..4000498 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
| PL330_RS19085 | 4000587..4002503 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
| PL330_RS19090 | 4002880..4003284 | + | 405 | WP_000843568.1 | DUF2541 family protein | - |
| PL330_RS19095 | 4003310..4004023 | + | 714 | WP_001102379.1 | acidic protein MsyB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T268694 WP_000809168.1 NZ_CP116411:3999112-3999264 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
Antitoxin
Download Length: 58 bp
>AT268694 NZ_CP116411:c3999063-3999006 [Escherichia coli]
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCAGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|