Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 567598..568397 | Replicon | chromosome |
| Accession | NZ_CP116411 | ||
| Organism | Escherichia coli strain HH45 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | U9XVR9 |
| Locus tag | PL330_RS02765 | Protein ID | WP_000347267.1 |
| Coordinates | 567598..568062 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | PL330_RS02770 | Protein ID | WP_001307405.1 |
| Coordinates | 568062..568397 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PL330_RS02735 (562599) | 562599..563033 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| PL330_RS02740 (563051) | 563051..563929 | - | 879 | WP_001380079.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PL330_RS02745 (563919) | 563919..564698 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PL330_RS02750 (564709) | 564709..565182 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PL330_RS02755 (565205) | 565205..566485 | - | 1281 | WP_000681920.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PL330_RS02760 (566734) | 566734..567543 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| PL330_RS02765 (567598) | 567598..568062 | - | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PL330_RS02770 (568062) | 568062..568397 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PL330_RS02775 (568546) | 568546..570117 | - | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| PL330_RS02780 (570492) | 570492..571826 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PL330_RS02785 (571842) | 571842..572612 | + | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T268682 WP_000347267.1 NZ_CP116411:c568062-567598 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XTR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |