Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 93255..93857 | Replicon | chromosome |
Accession | NZ_CP116409 | ||
Organism | Escherichia coli strain HH97 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | PL329_RS00415 | Protein ID | WP_000897302.1 |
Coordinates | 93546..93857 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PL329_RS00410 | Protein ID | WP_000356397.1 |
Coordinates | 93255..93545 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PL329_RS00385 (89202) | 89202..90104 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
PL329_RS00390 (90101) | 90101..90736 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
PL329_RS00395 (90733) | 90733..91662 | + | 930 | WP_000027705.1 | formate dehydrogenase accessory protein FdhE | - |
PL329_RS00400 (91992) | 91992..92234 | - | 243 | WP_001086388.1 | protein YiiF | - |
PL329_RS00405 (92452) | 92452..92670 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
PL329_RS00410 (93255) | 93255..93545 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PL329_RS00415 (93546) | 93546..93857 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
PL329_RS00420 (94086) | 94086..94994 | + | 909 | WP_271711088.1 | alpha/beta hydrolase | - |
PL329_RS00425 (95058) | 95058..95999 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
PL329_RS00430 (96044) | 96044..96481 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
PL329_RS00435 (96478) | 96478..97350 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
PL329_RS00440 (97344) | 97344..97943 | - | 600 | WP_001308174.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T268663 WP_000897302.1 NZ_CP116409:c93857-93546 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|