Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3732525..3733219 Replicon chromosome
Accession NZ_CP116405
Organism Escherichia coli strain HH107

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag PL328_RS18255 Protein ID WP_001263493.1
Coordinates 3732525..3732923 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag PL328_RS18260 Protein ID WP_000554757.1
Coordinates 3732926..3733219 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3728185) 3728185..3728265 - 81 NuclAT_11 - -
- (3728185) 3728185..3728265 - 81 NuclAT_11 - -
- (3728185) 3728185..3728265 - 81 NuclAT_11 - -
- (3728185) 3728185..3728265 - 81 NuclAT_11 - -
PL328_RS18225 (3727525) 3727525..3728769 - 1245 WP_044864403.1 esterase FrsA -
PL328_RS18230 (3728861) 3728861..3729319 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
PL328_RS18235 (3729580) 3729580..3731037 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
PL328_RS18240 (3731094) 3731094..3731615 - 522 Protein_3572 peptide chain release factor H -
PL328_RS18245 (3731614) 3731614..3731817 - 204 Protein_3573 RtcB family protein -
PL328_RS18250 (3732063) 3732063..3732515 - 453 WP_001059847.1 GNAT family N-acetyltransferase -
PL328_RS18255 (3732525) 3732525..3732923 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
PL328_RS18260 (3732926) 3732926..3733219 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
PL328_RS18265 (3733271) 3733271..3734326 - 1056 WP_001226164.1 DNA polymerase IV -
PL328_RS18270 (3734397) 3734397..3735320 - 924 WP_001232547.1 putative lateral flagellar export/assembly protein LafU -
PL328_RS18275 (3735323) 3735323..3736186 - 864 WP_001169518.1 flagellar motor stator protein MotA -
PL328_RS18280 (3736199) 3736199..3736915 - 717 WP_000938723.1 FliA/WhiG family RNA polymerase sigma factor -
PL328_RS18285 (3736935) 3736935..3737402 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T268657 WP_001263493.1 NZ_CP116405:c3732923-3732525 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT268657 WP_000554757.1 NZ_CP116405:c3733219-3732926 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References