Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 773626..774319 | Replicon | chromosome |
| Accession | NZ_CP116405 | ||
| Organism | Escherichia coli strain HH107 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | PL328_RS03715 | Protein ID | WP_000415584.1 |
| Coordinates | 773626..773922 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | PL328_RS03720 | Protein ID | WP_000650107.1 |
| Coordinates | 773924..774319 (+) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PL328_RS03685 (768646) | 768646..768978 | + | 333 | WP_000914691.1 | DUF2645 family protein | - |
| PL328_RS03690 (769024) | 769024..770373 | - | 1350 | WP_000673354.1 | quorum sensing histidine kinase QseC | - |
| PL328_RS03695 (770370) | 770370..771029 | - | 660 | WP_001221502.1 | quorum sensing response regulator transcription factor QseB | - |
| PL328_RS03700 (771181) | 771181..771573 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| PL328_RS03710 (772966) | 772966..773421 | + | 456 | WP_244557681.1 | GyrI-like domain-containing protein | - |
| PL328_RS03715 (773626) | 773626..773922 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| PL328_RS03720 (773924) | 773924..774319 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| PL328_RS03725 (774452) | 774452..776059 | + | 1608 | WP_096926439.1 | ABC transporter substrate-binding protein | - |
| PL328_RS03730 (776197) | 776197..778455 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T268644 WP_000415584.1 NZ_CP116405:773626-773922 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT268644 WP_000650107.1 NZ_CP116405:773924-774319 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|