Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 578975..579620 | Replicon | chromosome |
| Accession | NZ_CP116384 | ||
| Organism | Vibrio sp. SCSIO 43137 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PK654_RS18475 | Protein ID | WP_271700542.1 |
| Coordinates | 578975..579334 (+) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PK654_RS18480 | Protein ID | WP_271700543.1 |
| Coordinates | 579315..579620 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PK654_RS18450 (PK654_18450) | 574203..574769 | - | 567 | WP_271700537.1 | class GN sortase | - |
| PK654_RS18455 (PK654_18455) | 574751..576718 | - | 1968 | WP_271700538.1 | marine proteobacterial sortase target protein | - |
| PK654_RS18460 (PK654_18460) | 576816..577298 | - | 483 | WP_271700539.1 | hypothetical protein | - |
| PK654_RS18465 (PK654_18465) | 577378..577629 | - | 252 | WP_271700540.1 | hypothetical protein | - |
| PK654_RS18470 (PK654_18470) | 577822..578541 | - | 720 | WP_271700541.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| PK654_RS18475 (PK654_18475) | 578975..579334 | + | 360 | WP_271700542.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PK654_RS18480 (PK654_18480) | 579315..579620 | + | 306 | WP_271700543.1 | XRE family transcriptional regulator | Antitoxin |
| PK654_RS18485 (PK654_18485) | 579924..581393 | + | 1470 | WP_271700720.1 | cobyric acid synthase | - |
| PK654_RS18490 (PK654_18490) | 581390..582703 | + | 1314 | WP_271700544.1 | cobyrinate a,c-diamide synthase | - |
| PK654_RS18495 (PK654_18495) | 582700..583302 | + | 603 | WP_271700545.1 | histidine phosphatase family protein | - |
| PK654_RS18500 (PK654_18500) | 583275..583883 | + | 609 | WP_271700546.1 | histidine phosphatase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 575931..791825 | 215894 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13800.20 Da Isoelectric Point: 10.9550
>T268623 WP_271700542.1 NZ_CP116384:578975-579334 [Vibrio sp. SCSIO 43137]
MWNVVLRPVFIDWFRALESKDKINVRASIELLKQVGPNLSRPHADTLKGSRLRKLKELRVQSSGKPIRVLFAFDPERQCV
VLCGGNKTADKKFYKKIIPLAEREFSKHLKERNNEKPTS
MWNVVLRPVFIDWFRALESKDKINVRASIELLKQVGPNLSRPHADTLKGSRLRKLKELRVQSSGKPIRVLFAFDPERQCV
VLCGGNKTADKKFYKKIIPLAEREFSKHLKERNNEKPTS
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|