Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 6608927..6609631 | Replicon | chromosome |
Accession | NZ_CP116355 | ||
Organism | Streptomyces xanthophaeus strain KPP03845 |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | - |
Locus tag | KPP03845_RS30230 | Protein ID | WP_272261605.1 |
Coordinates | 6609272..6609631 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | KPP03845_RS30225 | Protein ID | WP_272261604.1 |
Coordinates | 6608927..6609238 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KPP03845_RS30200 (KPP03845_106032) | 6604149..6604322 | - | 174 | WP_272261599.1 | hypothetical protein | - |
KPP03845_RS30205 (KPP03845_106033) | 6604396..6604566 | - | 171 | WP_272261600.1 | hypothetical protein | - |
KPP03845_RS30210 (KPP03845_106034) | 6605328..6606458 | + | 1131 | WP_272261602.1 | helix-turn-helix transcriptional regulator | - |
KPP03845_RS30215 (KPP03845_106035) | 6606442..6607218 | - | 777 | WP_272263610.1 | NUDIX domain-containing protein | - |
KPP03845_RS30220 | 6607925..6608476 | - | 552 | WP_272261603.1 | hypothetical protein | - |
KPP03845_RS30225 | 6608927..6609238 | - | 312 | WP_272261604.1 | XRE family transcriptional regulator | Antitoxin |
KPP03845_RS30230 | 6609272..6609631 | - | 360 | WP_272261605.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
KPP03845_RS30235 (KPP03845_106036) | 6609808..6610917 | + | 1110 | WP_272261606.1 | ATP-binding protein | - |
KPP03845_RS30240 (KPP03845_106037) | 6611149..6612366 | + | 1218 | WP_272261607.1 | restriction endonuclease | - |
KPP03845_RS30245 (KPP03845_106038) | 6612434..6613408 | + | 975 | WP_272261608.1 | NaeI family type II restriction endonuclease | - |
KPP03845_RS30250 (KPP03845_106039) | 6613863..6614288 | + | 426 | WP_272261609.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13139.98 Da Isoelectric Point: 6.4858
>T268617 WP_272261605.1 NZ_CP116355:c6609631-6609272 [Streptomyces xanthophaeus]
VSWSVVVVDEVRDWLHLLRREDRETLLAISAAIDVLEAQGPGLGRPLVDTVHGSQLSHLKELRPGSSGSSEVRILFAFDP
ARQAVLLVAGDKSGNWKGWYESAIPVAEERYRVHVAKMA
VSWSVVVVDEVRDWLHLLRREDRETLLAISAAIDVLEAQGPGLGRPLVDTVHGSQLSHLKELRPGSSGSSEVRILFAFDP
ARQAVLLVAGDKSGNWKGWYESAIPVAEERYRVHVAKMA
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|