Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 45126..45790 | Replicon | chromosome |
| Accession | NZ_CP116249 | ||
| Organism | Enterobacter roggenkampii strain 120063 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | KK030_RS00225 | Protein ID | WP_214573812.1 |
| Coordinates | 45422..45790 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | KK030_RS00220 | Protein ID | WP_214573810.1 |
| Coordinates | 45126..45425 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KK030_RS00190 (KK030_00190) | 40534..41493 | - | 960 | WP_008500118.1 | DUF523 and DUF1722 domain-containing protein | - |
| KK030_RS00195 (KK030_00195) | 41596..42006 | - | 411 | WP_008500117.1 | hydroxyisourate hydrolase | - |
| KK030_RS00200 (KK030_00200) | 42106..42831 | - | 726 | WP_008500116.1 | MerR family transcriptional regulator | - |
| KK030_RS00205 (KK030_00205) | 42949..43473 | + | 525 | WP_008500115.1 | lipocalin family protein | - |
| KK030_RS00210 (KK030_00210) | 43552..44598 | + | 1047 | WP_214573806.1 | class I SAM-dependent methyltransferase | - |
| KK030_RS00215 (KK030_00215) | 44659..45096 | + | 438 | WP_214573808.1 | acetyltransferase | - |
| KK030_RS00220 (KK030_00220) | 45126..45425 | - | 300 | WP_214573810.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| KK030_RS00225 (KK030_00225) | 45422..45790 | - | 369 | WP_214573812.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| KK030_RS00230 (KK030_00230) | 46221..46562 | - | 342 | WP_214573814.1 | SymE family type I addiction module toxin | - |
| KK030_RS00235 (KK030_00235) | 46646..46843 | + | 198 | WP_045352823.1 | toxin-antitoxin system HicB family antitoxin | - |
| KK030_RS00240 (KK030_00240) | 46856..47713 | - | 858 | WP_045406904.1 | WYL domain-containing protein | - |
| KK030_RS00245 (KK030_00245) | 47893..48063 | + | 171 | WP_164725120.1 | hypothetical protein | - |
| KK030_RS00255 (KK030_00255) | 48809..50200 | + | 1392 | WP_214573822.1 | glycoside-pentoside-hexuronide family transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13999.01 Da Isoelectric Point: 9.3784
>T268547 WP_214573812.1 NZ_CP116249:c45790-45422 [Enterobacter roggenkampii]
VDGSVRFGSVRFGKVFEQWLFEQEEGLQDKVLADLLNLQHYGPRLPRPYADTVKGSRYKHMKELRIQYAGRPVRAFFAFD
AVRQAIVLCAGDKSNDKAFYEKMIRIADAEFSLHLTSQEAAK
VDGSVRFGSVRFGKVFEQWLFEQEEGLQDKVLADLLNLQHYGPRLPRPYADTVKGSRYKHMKELRIQYAGRPVRAFFAFD
AVRQAIVLCAGDKSNDKAFYEKMIRIADAEFSLHLTSQEAAK
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|