Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HigA
Location 2004927..2005518 Replicon chromosome
Accession NZ_CP116246
Organism Desulfovibrio vulgaris strain L2

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag PH214_RS08975 Protein ID WP_043629397.1
Coordinates 2005240..2005518 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag PH214_RS08970 Protein ID WP_011792270.1
Coordinates 2004927..2005229 (-) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PH214_RS08925 (PH214_08925) 2000319..2000807 + 489 WP_011792279.1 DUF2597 family protein -
PH214_RS08930 (PH214_08930) 2000816..2001022 + 207 WP_011793065.1 TraR/DksA C4-type zinc finger protein -
PH214_RS08935 (PH214_08935) 2001019..2001447 + 429 WP_271370122.1 structural protein -
PH214_RS08940 (PH214_08940) 2001444..2001794 + 351 WP_271370124.1 hypothetical protein -
PH214_RS08945 (PH214_08945) 2001796..2001993 + 198 WP_271370125.1 hypothetical protein -
PH214_RS08950 (PH214_08950) 2001990..2002304 + 315 WP_271370126.1 phage holin family protein -
PH214_RS08955 (PH214_08955) 2002314..2002574 + 261 WP_271370127.1 putative phage tail assembly chaperone -
PH214_RS08960 (PH214_08960) 2002780..2004576 + 1797 WP_271370128.1 phage tail tape measure protein -
PH214_RS08965 (PH214_08965) 2004580..2004906 + 327 WP_271370129.1 DUF2590 family protein -
PH214_RS08970 (PH214_08970) 2004927..2005229 - 303 WP_011792270.1 HigA family addiction module antitoxin Antitoxin
PH214_RS08975 (PH214_08975) 2005240..2005518 - 279 WP_043629397.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PH214_RS08980 (PH214_08980) 2005613..2006830 + 1218 WP_271370131.1 baseplate J/gp47 family protein -
PH214_RS08985 (PH214_08985) 2006827..2007438 + 612 WP_271370132.1 phage tail protein -
PH214_RS08990 (PH214_08990) 2007435..2008991 + 1557 WP_271370133.1 phage tail protein -
PH214_RS08995 (PH214_08995) 2009001..2009540 + 540 WP_271370134.1 phage tail protein -
PH214_RS09000 (PH214_09000) 2009543..2010478 + 936 WP_271370135.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1972791..2018067 45276


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(4-92)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(6-84)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10583.98 Da        Isoelectric Point: 8.5731

>T268545 WP_043629397.1 NZ_CP116246:c2005518-2005240 [Desulfovibrio vulgaris]
MIRSFAHKGLEDLFYDGTTKGVQQKHVRKLLDVLDLLDNAREVKDMGFPGSGLHQLKGNLNGHWAVKISGNWRMTFRFEN
GDAHVVNYQDYH

Download         Length: 279 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11244.09 Da        Isoelectric Point: 12.2681

>AT268545 WP_011792270.1 NZ_CP116246:c2005229-2004927 [Desulfovibrio vulgaris]
MRTRTRKPTHPGGILHRMHMEPLGLTITALAQQLGISRKALSAIVNERAAITPDIALRLSRALNTTPELWLNMQQAFTLW
ETAHTRTEWRAVQPVRAANA

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References