Detailed information of TA system TA268541

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 141857..142283
• Replicon: plasmid unnamed2
• Accession: NZ_CP116243
• Organism: Escherichia coli strain 7.1994/NIST0056

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PH192_RS24595
• Protein ID: WP_001372321.1
• Coordinates: 141857..141982 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	142059..142283 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PH192_RS24555 (137228)	137228..137917	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
PH192_RS24560 (138104)	138104..138487	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PH192_RS24565 (138808)	138808..139410	+	603	WP_000243709.1	transglycosylase SLT domain-containing protein	-
PH192_RS24570 (139707)	139707..140528	-	822	WP_001234480.1	DUF932 domain-containing protein	-
PH192_RS24575 (140648)	140648..140935	-	288	WP_000107535.1	hypothetical protein	-
PH192_RS24580 (140960)	140960..141166	-	207	WP_000547939.1	hypothetical protein	-
PH192_RS24585 (141236)	141236..141409	+	174	Protein_148	hypothetical protein	-
PH192_RS24590 (141407)	141407..141637	-	231	WP_001426396.1	hypothetical protein	-
PH192_RS24595 (141857)	141857..141982	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PH192_RS24600 (141924)	141924..142073	-	150	Protein_151	plasmid maintenance protein Mok	-
- (142059)	142059..142283	-	225	NuclAT_0	-	Antitoxin
- (142059)	142059..142283	-	225	NuclAT_0	-	Antitoxin
- (142059)	142059..142283	-	225	NuclAT_0	-	Antitoxin
- (142059)	142059..142283	-	225	NuclAT_0	-	Antitoxin
PH192_RS24605 (142095)	142095..142283	+	189	WP_001299721.1	hypothetical protein	-
PH192_RS24610 (142252)	142252..143014	-	763	Protein_153	plasmid SOS inhibition protein A	-
PH192_RS24615 (143011)	143011..143445	-	435	WP_000845901.1	conjugation system SOS inhibitor PsiB	-
PH192_RS24620 (143500)	143500..145458	-	1959	WP_001145469.1	ParB/RepB/Spo0J family partition protein	-
PH192_RS24625 (145517)	145517..145750	-	234	WP_000006004.1	DUF905 domain-containing protein	-
PH192_RS24630 (145806)	145806..146333	-	528	WP_000290793.1	single-stranded DNA-binding protein	-
PH192_RS24635 (146806)	146806..147060	-	255	WP_072163210.1	hypothetical protein	-
PH192_RS24640 (146976)	146976..147215	-	240	WP_240724493.1	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sitABCD	iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat	1..148536	148536

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T268541 WP_001372321.1 NZ_CP116243:c141982-141857 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT268541 NZ_CP116243:c142283-142059 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin