Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 141857..142283 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP116243 | ||
| Organism | Escherichia coli strain 7.1994/NIST0056 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PH192_RS24595 | Protein ID | WP_001372321.1 |
| Coordinates | 141857..141982 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 142059..142283 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH192_RS24555 (137228) | 137228..137917 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| PH192_RS24560 (138104) | 138104..138487 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PH192_RS24565 (138808) | 138808..139410 | + | 603 | WP_000243709.1 | transglycosylase SLT domain-containing protein | - |
| PH192_RS24570 (139707) | 139707..140528 | - | 822 | WP_001234480.1 | DUF932 domain-containing protein | - |
| PH192_RS24575 (140648) | 140648..140935 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| PH192_RS24580 (140960) | 140960..141166 | - | 207 | WP_000547939.1 | hypothetical protein | - |
| PH192_RS24585 (141236) | 141236..141409 | + | 174 | Protein_148 | hypothetical protein | - |
| PH192_RS24590 (141407) | 141407..141637 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| PH192_RS24595 (141857) | 141857..141982 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PH192_RS24600 (141924) | 141924..142073 | - | 150 | Protein_151 | plasmid maintenance protein Mok | - |
| - (142059) | 142059..142283 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (142059) | 142059..142283 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (142059) | 142059..142283 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (142059) | 142059..142283 | - | 225 | NuclAT_0 | - | Antitoxin |
| PH192_RS24605 (142095) | 142095..142283 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| PH192_RS24610 (142252) | 142252..143014 | - | 763 | Protein_153 | plasmid SOS inhibition protein A | - |
| PH192_RS24615 (143011) | 143011..143445 | - | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
| PH192_RS24620 (143500) | 143500..145458 | - | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| PH192_RS24625 (145517) | 145517..145750 | - | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| PH192_RS24630 (145806) | 145806..146333 | - | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
| PH192_RS24635 (146806) | 146806..147060 | - | 255 | WP_072163210.1 | hypothetical protein | - |
| PH192_RS24640 (146976) | 146976..147215 | - | 240 | WP_240724493.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..148536 | 148536 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T268541 WP_001372321.1 NZ_CP116243:c141982-141857 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT268541 NZ_CP116243:c142283-142059 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|