Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 97430..97684 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP116243 | ||
| Organism | Escherichia coli strain 7.1994/NIST0056 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PH192_RS24320 | Protein ID | WP_001312851.1 |
| Coordinates | 97430..97579 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 97623..97684 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH192_RS24285 (93760) | 93760..94047 | - | 288 | WP_000222766.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PH192_RS24290 (94044) | 94044..94295 | - | 252 | WP_001132900.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| PH192_RS24295 (95258) | 95258..96115 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| PH192_RS24300 (96108) | 96108..96590 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| PH192_RS24305 (96583) | 96583..96630 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| PH192_RS24310 (96621) | 96621..96872 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| PH192_RS24315 (96889) | 96889..97146 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| PH192_RS24320 (97430) | 97430..97579 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (97623) | 97623..97684 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (97623) | 97623..97684 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (97623) | 97623..97684 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (97623) | 97623..97684 | + | 62 | NuclAT_1 | - | Antitoxin |
| PH192_RS24325 (97940) | 97940..98014 | - | 75 | Protein_96 | endonuclease | - |
| PH192_RS24330 (98260) | 98260..98472 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| PH192_RS24335 (98549) | 98549..99212 | + | 664 | Protein_98 | IS66-like element accessory protein TnpA | - |
| PH192_RS24340 (99228) | 99228..99575 | + | 348 | WP_271356481.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PH192_RS24345 (99595) | 99595..99876 | + | 282 | WP_271356486.1 | transposase | - |
| PH192_RS24350 (99794) | 99794..101167 | + | 1374 | WP_271356489.1 | IS66 family transposase | - |
| PH192_RS24355 (101318) | 101318..101878 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..148536 | 148536 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T268536 WP_001312851.1 NZ_CP116243:c97579-97430 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT268536 NZ_CP116243:97623-97684 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
