Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 5567..5831 Replicon plasmid unnamed1
Accession NZ_CP116242
Organism Escherichia coli strain 7.1994/NIST0056

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag PH192_RS23200 Protein ID WP_001331364.1
Coordinates 5567..5719 (-) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 5774..5831 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PH192_RS23175 (845) 845..3007 + 2163 WP_000698351.1 DotA/TraY family protein -
PH192_RS23180 (3072) 3072..3734 + 663 WP_000653334.1 plasmid IncI1-type surface exclusion protein ExcA -
PH192_RS23185 (3806) 3806..4015 - 210 WP_000062603.1 HEAT repeat domain-containing protein -
PH192_RS23190 (4407) 4407..4583 + 177 WP_001054904.1 hypothetical protein -
PH192_RS23195 (4648) 4648..4743 - 96 WP_000609148.1 DinQ-like type I toxin DqlB -
PH192_RS23200 (5567) 5567..5719 - 153 WP_001331364.1 Hok/Gef family protein Toxin
- (5774) 5774..5831 + 58 NuclAT_0 - Antitoxin
- (5774) 5774..5831 + 58 NuclAT_0 - Antitoxin
- (5774) 5774..5831 + 58 NuclAT_0 - Antitoxin
- (5774) 5774..5831 + 58 NuclAT_0 - Antitoxin
PH192_RS23205 (6011) 6011..7219 + 1209 WP_000121274.1 IncI1-type conjugal transfer protein TrbA -
PH192_RS23210 (7238) 7238..8308 + 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
PH192_RS23215 (8301) 8301..10592 + 2292 WP_001289276.1 F-type conjugative transfer protein TrbC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / aac(3)-VIa / qacE / sul1 / tet(A) - 1..122629 122629


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T268528 WP_001331364.1 NZ_CP116242:c5719-5567 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 58 bp

>AT268528 NZ_CP116242:5774-5831 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References