Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 3768649..3769448 | Replicon | chromosome |
| Accession | NZ_CP116241 | ||
| Organism | Escherichia coli strain 7.1994/NIST0056 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | - |
| Locus tag | PH192_RS18290 | Protein ID | WP_033554209.1 |
| Coordinates | 3768649..3769113 (-) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | PH192_RS18295 | Protein ID | WP_001307405.1 |
| Coordinates | 3769113..3769448 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH192_RS18260 (3763650) | 3763650..3764084 | - | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
| PH192_RS18265 (3764102) | 3764102..3764980 | - | 879 | WP_033554389.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PH192_RS18270 (3764970) | 3764970..3765749 | - | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PH192_RS18275 (3765760) | 3765760..3766233 | - | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PH192_RS18280 (3766256) | 3766256..3767536 | - | 1281 | WP_000681921.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PH192_RS18285 (3767785) | 3767785..3768594 | + | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| PH192_RS18290 (3768649) | 3768649..3769113 | - | 465 | WP_033554209.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PH192_RS18295 (3769113) | 3769113..3769448 | - | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PH192_RS18300 (3769597) | 3769597..3771167 | - | 1571 | Protein_3570 | galactarate dehydratase | - |
| PH192_RS18305 (3771542) | 3771542..3772876 | + | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PH192_RS18310 (3772892) | 3772892..3773662 | + | 771 | WP_001058226.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17811.16 Da Isoelectric Point: 9.4947
>T268524 WP_033554209.1 NZ_CP116241:c3769113-3768649 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRFFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|