Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
| Location | 3429134..3429355 | Replicon | chromosome |
| Accession | NZ_CP116241 | ||
| Organism | Escherichia coli strain 7.1994/NIST0056 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | PH192_RS16555 | Protein ID | WP_001295224.1 |
| Coordinates | 3429134..3429241 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 3429290..3429355 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH192_RS16530 (3424388) | 3424388..3425140 | - | 753 | WP_000279528.1 | cellulose biosynthesis protein BcsQ | - |
| PH192_RS16535 (3425152) | 3425152..3425340 | - | 189 | WP_001063318.1 | cellulose biosynthesis protein BcsR | - |
| PH192_RS16540 (3425613) | 3425613..3427184 | + | 1572 | WP_001204906.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| PH192_RS16545 (3427181) | 3427181..3427372 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| PH192_RS16550 (3427369) | 3427369..3429048 | + | 1680 | WP_000191590.1 | cellulose biosynthesis protein BcsG | - |
| PH192_RS16555 (3429134) | 3429134..3429241 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (3429290) | 3429290..3429355 | + | 66 | NuclAT_15 | - | Antitoxin |
| - (3429290) | 3429290..3429355 | + | 66 | NuclAT_15 | - | Antitoxin |
| - (3429290) | 3429290..3429355 | + | 66 | NuclAT_15 | - | Antitoxin |
| - (3429290) | 3429290..3429355 | + | 66 | NuclAT_15 | - | Antitoxin |
| - (3429290) | 3429290..3429355 | + | 66 | NuclAT_26 | - | Antitoxin |
| - (3429290) | 3429290..3429355 | + | 66 | NuclAT_26 | - | Antitoxin |
| - (3429290) | 3429290..3429355 | + | 66 | NuclAT_26 | - | Antitoxin |
| - (3429290) | 3429290..3429355 | + | 66 | NuclAT_26 | - | Antitoxin |
| PH192_RS16560 (3429617) | 3429617..3429724 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (3429781) | 3429781..3429838 | + | 58 | NuclAT_16 | - | - |
| - (3429781) | 3429781..3429838 | + | 58 | NuclAT_16 | - | - |
| - (3429781) | 3429781..3429838 | + | 58 | NuclAT_16 | - | - |
| - (3429781) | 3429781..3429838 | + | 58 | NuclAT_16 | - | - |
| - (3429781) | 3429781..3429838 | + | 58 | NuclAT_27 | - | - |
| - (3429781) | 3429781..3429838 | + | 58 | NuclAT_27 | - | - |
| - (3429781) | 3429781..3429838 | + | 58 | NuclAT_27 | - | - |
| - (3429781) | 3429781..3429838 | + | 58 | NuclAT_27 | - | - |
| PH192_RS16565 (3430100) | 3430100..3430207 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | - |
| - (3430256) | 3430256..3430321 | + | 66 | NuclAT_14 | - | - |
| - (3430256) | 3430256..3430321 | + | 66 | NuclAT_14 | - | - |
| - (3430256) | 3430256..3430321 | + | 66 | NuclAT_14 | - | - |
| - (3430256) | 3430256..3430321 | + | 66 | NuclAT_14 | - | - |
| - (3430256) | 3430256..3430321 | + | 66 | NuclAT_25 | - | - |
| - (3430256) | 3430256..3430321 | + | 66 | NuclAT_25 | - | - |
| - (3430256) | 3430256..3430321 | + | 66 | NuclAT_25 | - | - |
| - (3430256) | 3430256..3430321 | + | 66 | NuclAT_25 | - | - |
| PH192_RS16570 (3430683) | 3430683..3431954 | + | 1272 | WP_033554172.1 | aromatic amino acid transport family protein | - |
| PH192_RS16575 (3431984) | 3431984..3432988 | - | 1005 | WP_000107030.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| PH192_RS16580 (3432985) | 3432985..3433968 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T268516 WP_001295224.1 NZ_CP116241:c3429241-3429134 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
Antitoxin
Download Length: 66 bp
>AT268516 NZ_CP116241:3429290-3429355 [Escherichia coli]
GTCTAGATGCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGATGCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|