Detailed information of TA system TA268516

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-agrB/Ldr(toxin)
• Location: 3429134..3429355
• Replicon: chromosome
• Accession: NZ_CP116241
• Organism: Escherichia coli strain 7.1994/NIST0056

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: S1NWX0
• Locus tag: PH192_RS16555
• Protein ID: WP_001295224.1
• Coordinates: 3429134..3429241 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	agrB
Locus tag	-
Coordinates	3429290..3429355 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PH192_RS16530 (3424388)	3424388..3425140	-	753	WP_000279528.1	cellulose biosynthesis protein BcsQ	-
PH192_RS16535 (3425152)	3425152..3425340	-	189	WP_001063318.1	cellulose biosynthesis protein BcsR	-
PH192_RS16540 (3425613)	3425613..3427184	+	1572	WP_001204906.1	cellulose biosynthesis c-di-GMP-binding protein BcsE	-
PH192_RS16545 (3427181)	3427181..3427372	+	192	WP_000988308.1	cellulose biosynthesis protein BcsF	-
PH192_RS16550 (3427369)	3427369..3429048	+	1680	WP_000191590.1	cellulose biosynthesis protein BcsG	-
PH192_RS16555 (3429134)	3429134..3429241	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
- (3429290)	3429290..3429355	+	66	NuclAT_15	-	Antitoxin
- (3429290)	3429290..3429355	+	66	NuclAT_15	-	Antitoxin
- (3429290)	3429290..3429355	+	66	NuclAT_15	-	Antitoxin
- (3429290)	3429290..3429355	+	66	NuclAT_15	-	Antitoxin
- (3429290)	3429290..3429355	+	66	NuclAT_26	-	Antitoxin
- (3429290)	3429290..3429355	+	66	NuclAT_26	-	Antitoxin
- (3429290)	3429290..3429355	+	66	NuclAT_26	-	Antitoxin
- (3429290)	3429290..3429355	+	66	NuclAT_26	-	Antitoxin
PH192_RS16560 (3429617)	3429617..3429724	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
- (3429781)	3429781..3429838	+	58	NuclAT_16	-	-
- (3429781)	3429781..3429838	+	58	NuclAT_16	-	-
- (3429781)	3429781..3429838	+	58	NuclAT_16	-	-
- (3429781)	3429781..3429838	+	58	NuclAT_16	-	-
- (3429781)	3429781..3429838	+	58	NuclAT_27	-	-
- (3429781)	3429781..3429838	+	58	NuclAT_27	-	-
- (3429781)	3429781..3429838	+	58	NuclAT_27	-	-
- (3429781)	3429781..3429838	+	58	NuclAT_27	-	-
PH192_RS16565 (3430100)	3430100..3430207	-	108	WP_000141634.1	type I toxin-antitoxin system toxic polypeptide LdrD	-
- (3430256)	3430256..3430321	+	66	NuclAT_14	-	-
- (3430256)	3430256..3430321	+	66	NuclAT_14	-	-
- (3430256)	3430256..3430321	+	66	NuclAT_14	-	-
- (3430256)	3430256..3430321	+	66	NuclAT_14	-	-
- (3430256)	3430256..3430321	+	66	NuclAT_25	-	-
- (3430256)	3430256..3430321	+	66	NuclAT_25	-	-
- (3430256)	3430256..3430321	+	66	NuclAT_25	-	-
- (3430256)	3430256..3430321	+	66	NuclAT_25	-	-
PH192_RS16570 (3430683)	3430683..3431954	+	1272	WP_033554172.1	aromatic amino acid transport family protein	-
PH192_RS16575 (3431984)	3431984..3432988	-	1005	WP_000107030.1	dipeptide ABC transporter ATP-binding subunit DppF	-
PH192_RS16580 (3432985)	3432985..3433968	-	984	WP_001196486.1	dipeptide ABC transporter ATP-binding protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3882.70 Da
• Isoelectric Point: 9.0157

>T268516 WP_001295224.1 NZ_CP116241:c3429241-3429134 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT268516 NZ_CP116241:3429290-3429355 [Escherichia coli]
GTCTAGATGCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A4P7TSJ7

Antitoxin