Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 2978650..2979252 | Replicon | chromosome |
Accession | NZ_CP116241 | ||
Organism | Escherichia coli strain 7.1994/NIST0056 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | PH192_RS14420 | Protein ID | WP_000897305.1 |
Coordinates | 2978941..2979252 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PH192_RS14415 | Protein ID | WP_000356397.1 |
Coordinates | 2978650..2978940 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PH192_RS14390 (2974576) | 2974576..2975478 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
PH192_RS14395 (2975475) | 2975475..2976110 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
PH192_RS14400 (2976107) | 2976107..2977036 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
PH192_RS14405 (2977366) | 2977366..2977608 | - | 243 | WP_001086388.1 | protein YiiF | - |
PH192_RS14410 (2977827) | 2977827..2978045 | - | 219 | WP_001297075.1 | CopG family transcriptional regulator | - |
PH192_RS14415 (2978650) | 2978650..2978940 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PH192_RS14420 (2978941) | 2978941..2979252 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
PH192_RS14425 (2979481) | 2979481..2980389 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
PH192_RS14430 (2980453) | 2980453..2981394 | - | 942 | WP_001343389.1 | fatty acid biosynthesis protein FabY | - |
PH192_RS14435 (2981439) | 2981439..2981876 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
PH192_RS14440 (2981873) | 2981873..2982745 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
PH192_RS14445 (2982739) | 2982739..2983338 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T268514 WP_000897305.1 NZ_CP116241:c2979252-2978941 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|