Detailed information of TA system TA268508

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 1012429..1012649
• Replicon: chromosome
• Accession: NZ_CP116241
• Organism: Escherichia coli strain 7.1994/NIST0056

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: PH192_RS04910
• Protein ID: WP_000170965.1
• Coordinates: 1012542..1012649 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	1012429..1012495 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PH192_RS04885	1007708..1009102	-	1395	WP_033554468.1	inverse autotransporter invasin YchO	-
PH192_RS04890	1009287..1009640	+	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
PH192_RS04895	1009684..1010379	-	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
PH192_RS04900	1010537..1010767	-	231	WP_001146442.1	putative cation transport regulator ChaB	-
PH192_RS04905	1011037..1012137	+	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
-	1012429..1012495	-	67	-	-	Antitoxin
PH192_RS04910	1012542..1012649	+	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	1012964..1013027	-	64	NuclAT_18	-	-
-	1012964..1013027	-	64	NuclAT_18	-	-
-	1012964..1013027	-	64	NuclAT_18	-	-
-	1012964..1013027	-	64	NuclAT_18	-	-
-	1012964..1013027	-	64	NuclAT_20	-	-
-	1012964..1013027	-	64	NuclAT_20	-	-
-	1012964..1013027	-	64	NuclAT_20	-	-
-	1012964..1013027	-	64	NuclAT_20	-	-
-	1012964..1013027	-	64	NuclAT_22	-	-
-	1012964..1013027	-	64	NuclAT_22	-	-
-	1012964..1013027	-	64	NuclAT_22	-	-
-	1012964..1013027	-	64	NuclAT_22	-	-
-	1012964..1013027	-	64	NuclAT_24	-	-
-	1012964..1013027	-	64	NuclAT_24	-	-
-	1012964..1013027	-	64	NuclAT_24	-	-
-	1012964..1013027	-	64	NuclAT_24	-	-
-	1012964..1013027	-	64	NuclAT_29	-	-
-	1012964..1013027	-	64	NuclAT_29	-	-
-	1012964..1013027	-	64	NuclAT_29	-	-
-	1012964..1013027	-	64	NuclAT_29	-	-
-	1012964..1013027	-	64	NuclAT_31	-	-
-	1012964..1013027	-	64	NuclAT_31	-	-
-	1012964..1013027	-	64	NuclAT_31	-	-
-	1012964..1013027	-	64	NuclAT_31	-	-
PH192_RS04915	1013077..1013184	+	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
PH192_RS04920	1013333..1014187	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
PH192_RS04925	1014223..1015032	-	810	WP_001257044.1	invasion regulator SirB1	-
PH192_RS04930	1015036..1015428	-	393	WP_000200374.1	invasion regulator SirB2	-
PH192_RS04935	1015425..1016258	-	834	WP_000456571.1	peptide chain release factor N(5)-glutamine methyltransferase	-
PH192_RS04940	1016258..1017340	-	1083	WP_000804726.1	peptide chain release factor 1	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T268508 WP_000170965.1 NZ_CP116241:1012542-1012649 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

Antitoxin

Nucleotide

• Length: 67 bp

>AT268508 NZ_CP116241:c1012495-1012429 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin