Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1594987..1595568 | Replicon | chromosome |
Accession | NZ_CP116236 | ||
Organism | Gordonia polyisoprenivorans strain 135 |
Toxin (Protein)
Gene name | graT | Uniprot ID | - |
Locus tag | PHA63_RS06920 | Protein ID | WP_271355208.1 |
Coordinates | 1595287..1595568 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PHA63_RS06915 | Protein ID | WP_208795105.1 |
Coordinates | 1594987..1595271 (-) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA63_RS06890 (PHA63_06890) | 1590093..1590983 | + | 891 | Protein_1364 | MazG family protein | - |
PHA63_RS06895 (PHA63_06895) | 1591273..1592022 | - | 750 | WP_020171998.1 | GntR family transcriptional regulator | - |
PHA63_RS06900 (PHA63_06900) | 1592125..1592550 | - | 426 | WP_020171997.1 | hypothetical protein | - |
PHA63_RS06905 (PHA63_06905) | 1592712..1593395 | - | 684 | WP_271355206.1 | phosphonatase-like hydrolase | - |
PHA63_RS06910 (PHA63_06910) | 1593458..1594603 | - | 1146 | WP_271355207.1 | TIGR03364 family FAD-dependent oxidoreductase | - |
PHA63_RS06915 (PHA63_06915) | 1594987..1595271 | - | 285 | WP_208795105.1 | HigA family addiction module antitoxin | Antitoxin |
PHA63_RS06920 (PHA63_06920) | 1595287..1595568 | - | 282 | WP_271355208.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PHA63_RS06925 (PHA63_06925) | 1595671..1596309 | + | 639 | WP_020171992.1 | GntR family transcriptional regulator | - |
PHA63_RS06930 (PHA63_06930) | 1596306..1597562 | + | 1257 | WP_271355209.1 | MFS transporter | - |
PHA63_RS06935 (PHA63_06935) | 1597588..1598016 | + | 429 | WP_271355210.1 | LysR family transcriptional regulator | - |
PHA63_RS06940 (PHA63_06940) | 1597959..1598474 | + | 516 | WP_271355751.1 | LysR family substrate-binding domain-containing protein | - |
PHA63_RS06945 (PHA63_06945) | 1598544..1599545 | + | 1002 | WP_231386713.1 | alpha/beta hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10623.08 Da Isoelectric Point: 8.0666
>T268490 WP_271355208.1 NZ_CP116236:c1595568-1595287 [Gordonia polyisoprenivorans]
VIQSFATKDTERVWARKFVPRLGPELTRVAHRKLQALDAAQRLADLASPPGNRLEPLSGDRAEQHSIRVNDQYRLCFTWT
PVGPVDMEIVDYH
VIQSFATKDTERVWARKFVPRLGPELTRVAHRKLQALDAAQRLADLASPPGNRLEPLSGDRAEQHSIRVNDQYRLCFTWT
PVGPVDMEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|