Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 40526..41176 | Replicon | chromosome |
| Accession | NZ_CP116214 | ||
| Organism | Klebsiella michiganensis strain 2563 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A0H3H3K0 |
| Locus tag | PHA56_RS00195 | Protein ID | WP_014227314.1 |
| Coordinates | 40526..40867 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0H3H3Q5 |
| Locus tag | PHA56_RS00200 | Protein ID | WP_014227313.1 |
| Coordinates | 40877..41176 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA56_RS00180 (PHA56_00180) | 36518..37837 | + | 1320 | WP_014227316.1 | MFS transporter | - |
| PHA56_RS00185 (PHA56_00185) | 37983..39374 | + | 1392 | WP_004126843.1 | hexose-6-phosphate:phosphate antiporter | - |
| PHA56_RS00190 (PHA56_00190) | 39823..40275 | + | 453 | WP_014839842.1 | DUF1198 domain-containing protein | - |
| PHA56_RS00195 (PHA56_00195) | 40526..40867 | + | 342 | WP_014227314.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PHA56_RS00200 (PHA56_00200) | 40877..41176 | + | 300 | WP_014227313.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| PHA56_RS00205 (PHA56_00205) | 41295..42476 | + | 1182 | WP_014227312.1 | purine ribonucleoside efflux pump NepI | - |
| PHA56_RS00210 (PHA56_00210) | 42509..43318 | - | 810 | WP_004855618.1 | phosphonoacetaldehyde hydrolase | - |
| PHA56_RS00215 (PHA56_00215) | 43328..44431 | - | 1104 | WP_014227310.1 | 2-aminoethylphosphonate--pyruvate transaminase | - |
| PHA56_RS00220 (PHA56_00220) | 44572..45291 | + | 720 | WP_076752428.1 | phosphonate utilization transcriptional regulator PhnR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13110.00 Da Isoelectric Point: 5.7545
>T268448 WP_014227314.1 NZ_CP116214:40526-40867 [Klebsiella michiganensis]
MWDVETTEVFDKWFEAQTEALKEDMLAAMVILSEYGPRLGRPFADTVNDSAFSNMKELRIQHQGRPIRAFFVFDPSRCGI
VLCAGDKTGLNEKRFYKDMIKLADAEYRKHLNQ
MWDVETTEVFDKWFEAQTEALKEDMLAAMVILSEYGPRLGRPFADTVNDSAFSNMKELRIQHQGRPIRAFFVFDPSRCGI
VLCAGDKTGLNEKRFYKDMIKLADAEYRKHLNQ
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H3K0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3H3Q5 |