Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 40775..41039 | Replicon | plasmid pDETEC89 |
| Accession | NZ_CP116200 | ||
| Organism | Escherichia coli strain DETEC-C31 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | PIB97_RS24875 | Protein ID | WP_001387489.1 |
| Coordinates | 40887..41039 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 40775..40835 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB97_RS24860 (36877) | 36877..37947 | - | 1071 | WP_012783932.1 | IncI1-type conjugal transfer protein TrbB | - |
| PIB97_RS24865 (37966) | 37966..39174 | - | 1209 | WP_001703845.1 | IncI1-type conjugal transfer protein TrbA | - |
| - (39354) | 39354..39411 | - | 58 | NuclAT_1 | - | - |
| - (39354) | 39354..39411 | - | 58 | NuclAT_1 | - | - |
| - (39354) | 39354..39411 | - | 58 | NuclAT_1 | - | - |
| - (39354) | 39354..39411 | - | 58 | NuclAT_1 | - | - |
| PIB97_RS24870 (39481) | 39481..40566 | - | 1086 | WP_000080543.1 | protein finQ | - |
| - (40775) | 40775..40835 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (40775) | 40775..40835 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (40775) | 40775..40835 | - | 61 | NuclAT_0 | - | Antitoxin |
| - (40775) | 40775..40835 | - | 61 | NuclAT_0 | - | Antitoxin |
| PIB97_RS24875 (40887) | 40887..41039 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| PIB97_RS24880 (41111) | 41111..41362 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| PIB97_RS24885 (41863) | 41863..41958 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| PIB97_RS24890 (42023) | 42023..42199 | - | 177 | WP_001054900.1 | hypothetical protein | - |
| PIB97_RS24895 (42591) | 42591..42800 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| PIB97_RS24900 (42872) | 42872..43534 | - | 663 | WP_012783935.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| PIB97_RS24905 (43605) | 43605..45773 | - | 2169 | WP_015508354.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-55 | - | 1..86715 | 86715 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T268442 WP_001387489.1 NZ_CP116200:40887-41039 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT268442 NZ_CP116200:c40835-40775 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|