Detailed information of TA system TA268439

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 83344..83770
• Replicon: plasmid pDETEC88
• Accession: NZ_CP116199
• Organism: Escherichia coli strain DETEC-C31

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIB97_RS24465
• Protein ID: WP_001372321.1
• Coordinates: 83344..83469 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	83546..83770 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIB97_RS24425 (78718)	78718..79407	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
PIB97_RS24430 (79594)	79594..79977	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIB97_RS24435 (80298)	80298..80900	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
PIB97_RS24440 (81197)	81197..82018	-	822	WP_001234426.1	DUF932 domain-containing protein	-
PIB97_RS24445 (82136)	82136..82423	-	288	WP_000107535.1	hypothetical protein	-
PIB97_RS24450 (82448)	82448..82654	-	207	WP_000547968.1	hypothetical protein	-
PIB97_RS24455 (82724)	82724..82896	+	173	Protein_99	hypothetical protein	-
PIB97_RS24460 (82894)	82894..83124	-	231	WP_071586998.1	hypothetical protein	-
PIB97_RS24465 (83344)	83344..83469	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIB97_RS24470 (83411)	83411..83560	-	150	Protein_102	plasmid maintenance protein Mok	-
- (83546)	83546..83770	-	225	NuclAT_0	-	Antitoxin
- (83546)	83546..83770	-	225	NuclAT_0	-	Antitoxin
- (83546)	83546..83770	-	225	NuclAT_0	-	Antitoxin
- (83546)	83546..83770	-	225	NuclAT_0	-	Antitoxin
PIB97_RS24475 (83582)	83582..83770	+	189	WP_001299721.1	hypothetical protein	-
PIB97_RS24480 (83739)	83739..84501	-	763	Protein_104	plasmid SOS inhibition protein A	-
PIB97_RS24485 (84498)	84498..84932	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
PIB97_RS24490 (84987)	84987..85184	-	198	Protein_106	hypothetical protein	-
PIB97_RS24495 (85212)	85212..85445	-	234	WP_000005987.1	DUF905 family protein	-
PIB97_RS24500 (85513)	85513..86052	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
PIB97_RS24505 (86078)	86078..86284	-	207	WP_000275856.1	hypothetical protein	-
PIB97_RS24510 (86354)	86354..86434	+	81	Protein_110	hypothetical protein	-
PIB97_RS24515 (86617)	86617..86786	-	170	Protein_111	hypothetical protein	-
PIB97_RS24520 (87380)	87380..88351	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	aph(3')-Ia / blaCTX-M-55 / sitABCD	iutA / iucD / iucC / iucB / iucA	1..111058	111058

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T268439 WP_001372321.1 NZ_CP116199:c83469-83344 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT268439 NZ_CP116199:c83770-83546 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin