Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4689367..4689969 | Replicon | chromosome |
Accession | NZ_CP116197 | ||
Organism | Escherichia coli strain DETEC-C31 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | PIB97_RS22350 | Protein ID | WP_000897305.1 |
Coordinates | 4689658..4689969 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PIB97_RS22345 | Protein ID | WP_000356397.1 |
Coordinates | 4689367..4689657 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB97_RS22320 (4685311) | 4685311..4686213 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
PIB97_RS22325 (4686210) | 4686210..4686845 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
PIB97_RS22330 (4686842) | 4686842..4687771 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
PIB97_RS22335 (4688101) | 4688101..4688343 | - | 243 | WP_001087409.1 | protein YiiF | - |
PIB97_RS22340 (4688563) | 4688563..4688781 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
PIB97_RS22345 (4689367) | 4689367..4689657 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PIB97_RS22350 (4689658) | 4689658..4689969 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
PIB97_RS22355 (4690198) | 4690198..4691106 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
PIB97_RS22360 (4691170) | 4691170..4692111 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
PIB97_RS22365 (4692156) | 4692156..4692593 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
PIB97_RS22370 (4692590) | 4692590..4693462 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
PIB97_RS22375 (4693456) | 4693456..4694055 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
PIB97_RS22380 (4694154) | 4694154..4694939 | - | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T268432 WP_000897305.1 NZ_CP116197:c4689969-4689658 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|