Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4934886..4935488 | Replicon | chromosome |
| Accession | NZ_CP116194 | ||
| Organism | Escherichia coli strain DETEC-E1005 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | PIB63_RS24020 | Protein ID | WP_000897302.1 |
| Coordinates | 4934886..4935197 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PIB63_RS24025 | Protein ID | WP_000356397.1 |
| Coordinates | 4935198..4935488 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB63_RS23990 (4929916) | 4929916..4930701 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PIB63_RS23995 (4930800) | 4930800..4931399 | + | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
| PIB63_RS24000 (4931393) | 4931393..4932265 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| PIB63_RS24005 (4932262) | 4932262..4932699 | + | 438 | WP_000560978.1 | D-aminoacyl-tRNA deacylase | - |
| PIB63_RS24010 (4932744) | 4932744..4933685 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| PIB63_RS24015 (4933749) | 4933749..4934657 | - | 909 | WP_001774092.1 | alpha/beta hydrolase | - |
| PIB63_RS24020 (4934886) | 4934886..4935197 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| PIB63_RS24025 (4935198) | 4935198..4935488 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| PIB63_RS24030 (4935847) | 4935847..4936125 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| PIB63_RS24035 (4936521) | 4936521..4936739 | + | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
| PIB63_RS24040 (4936955) | 4936955..4937884 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
| PIB63_RS24045 (4937881) | 4937881..4938516 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PIB63_RS24050 (4938513) | 4938513..4939415 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T268409 WP_000897302.1 NZ_CP116194:4934886-4935197 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|