Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 3970873..3971566 | Replicon | chromosome |
| Accession | NZ_CP116194 | ||
| Organism | Escherichia coli strain DETEC-E1005 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | S1EZG2 |
| Locus tag | PIB63_RS19355 | Protein ID | WP_000415584.1 |
| Coordinates | 3971270..3971566 (-) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | S1EBV2 |
| Locus tag | PIB63_RS19350 | Protein ID | WP_000650107.1 |
| Coordinates | 3970873..3971268 (-) | Length | 132 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB63_RS19340 (3966737) | 3966737..3968995 | - | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
| PIB63_RS19345 (3969133) | 3969133..3970740 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
| PIB63_RS19350 (3970873) | 3970873..3971268 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
| PIB63_RS19355 (3971270) | 3971270..3971566 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
| PIB63_RS19360 (3971771) | 3971771..3972253 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
| PIB63_RS19365 (3972306) | 3972306..3972698 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
| PIB63_RS19370 (3972850) | 3972850..3973509 | + | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
| PIB63_RS19375 (3973506) | 3973506..3974855 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
| PIB63_RS19380 (3974901) | 3974901..3975233 | - | 333 | WP_000917685.1 | DUF2645 family protein | - |
| PIB63_RS19385 (3975552) | 3975552..3976133 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
| PIB63_RS19390 (3976164) | 3976164..3976478 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3962410..3971566 | 9156 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T268406 WP_000415584.1 NZ_CP116194:c3971566-3971270 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT268406 WP_000650107.1 NZ_CP116194:c3971268-3970873 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|