Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 1003358..1004052 | Replicon | chromosome |
| Accession | NZ_CP116194 | ||
| Organism | Escherichia coli strain DETEC-E1005 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | S1PJQ2 |
| Locus tag | PIB63_RS04845 | Protein ID | WP_001263500.1 |
| Coordinates | 1003654..1004052 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | PIB63_RS04840 | Protein ID | WP_000554758.1 |
| Coordinates | 1003358..1003651 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB63_RS04815 (999175) | 999175..999642 | + | 468 | WP_000725261.1 | flagellar basal body-associated FliL family protein | - |
| PIB63_RS04820 (999662) | 999662..1000378 | + | 717 | WP_000938731.1 | FliA/WhiG family RNA polymerase sigma factor | - |
| PIB63_RS04825 (1000391) | 1000391..1001254 | + | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
| PIB63_RS04830 (1001257) | 1001257..1002180 | + | 924 | WP_001532973.1 | putative lateral flagellar export/assembly protein LafU | - |
| PIB63_RS04835 (1002251) | 1002251..1003306 | + | 1056 | WP_001226168.1 | DNA polymerase IV | - |
| PIB63_RS04840 (1003358) | 1003358..1003651 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| PIB63_RS04845 (1003654) | 1003654..1004052 | + | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| PIB63_RS04850 (1004062) | 1004062..1004514 | + | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
| PIB63_RS04855 (1004704) | 1004704..1005843 | + | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
| PIB63_RS04860 (1005840) | 1005840..1006454 | + | 615 | WP_000602124.1 | peptide chain release factor H | - |
| PIB63_RS04865 (1006511) | 1006511..1007968 | - | 1458 | WP_271291445.1 | cytosol nonspecific dipeptidase | - |
| PIB63_RS04870 (1008229) | 1008229..1008687 | + | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T268395 WP_001263500.1 NZ_CP116194:1003654-1004052 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|