Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4933569..4934171 | Replicon | chromosome |
Accession | NZ_CP116191 | ||
Organism | Escherichia coli strain DETEC-E1070 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | PIC72_RS24015 | Protein ID | WP_000897302.1 |
Coordinates | 4933569..4933880 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PIC72_RS24020 | Protein ID | WP_000356397.1 |
Coordinates | 4933881..4934171 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC72_RS23985 (4928599) | 4928599..4929384 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
PIC72_RS23990 (4929483) | 4929483..4930082 | + | 600 | WP_001314324.1 | glucose-1-phosphatase | - |
PIC72_RS23995 (4930076) | 4930076..4930948 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
PIC72_RS24000 (4930945) | 4930945..4931382 | + | 438 | WP_000560978.1 | D-aminoacyl-tRNA deacylase | - |
PIC72_RS24005 (4931427) | 4931427..4932368 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
PIC72_RS24010 (4932432) | 4932432..4933340 | - | 909 | WP_001774092.1 | alpha/beta hydrolase | - |
PIC72_RS24015 (4933569) | 4933569..4933880 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
PIC72_RS24020 (4933881) | 4933881..4934171 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PIC72_RS24025 (4934530) | 4934530..4934808 | + | 279 | WP_001296612.1 | hypothetical protein | - |
PIC72_RS24030 (4935204) | 4935204..4935422 | + | 219 | WP_001314326.1 | CopG family transcriptional regulator | - |
PIC72_RS24035 (4935638) | 4935638..4936567 | - | 930 | WP_000027720.1 | formate dehydrogenase accessory protein FdhE | - |
PIC72_RS24040 (4936564) | 4936564..4937199 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
PIC72_RS24045 (4937196) | 4937196..4938098 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T268382 WP_000897302.1 NZ_CP116191:4933569-4933880 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|