Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 3969556..3970249 | Replicon | chromosome |
Accession | NZ_CP116191 | ||
Organism | Escherichia coli strain DETEC-E1070 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | PIC72_RS19350 | Protein ID | WP_000415584.1 |
Coordinates | 3969953..3970249 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | PIC72_RS19345 | Protein ID | WP_000650107.1 |
Coordinates | 3969556..3969951 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC72_RS19335 (3965420) | 3965420..3967678 | - | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
PIC72_RS19340 (3967816) | 3967816..3969423 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
PIC72_RS19345 (3969556) | 3969556..3969951 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
PIC72_RS19350 (3969953) | 3969953..3970249 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
PIC72_RS19355 (3970454) | 3970454..3970936 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
PIC72_RS19360 (3970989) | 3970989..3971381 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
PIC72_RS19365 (3971533) | 3971533..3972192 | + | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
PIC72_RS19370 (3972189) | 3972189..3973538 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
PIC72_RS19375 (3973584) | 3973584..3973916 | - | 333 | WP_000917685.1 | DUF2645 family protein | - |
PIC72_RS19380 (3974235) | 3974235..3974816 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
PIC72_RS19385 (3974847) | 3974847..3975161 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3961093..3970249 | 9156 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T268379 WP_000415584.1 NZ_CP116191:c3970249-3969953 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT268379 WP_000650107.1 NZ_CP116191:c3969951-3969556 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|