Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 1231085..1231764 | Replicon | chromosome |
| Accession | NZ_CP116191 | ||
| Organism | Escherichia coli strain DETEC-E1070 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | PIC72_RS05900 | Protein ID | WP_000057523.1 |
| Coordinates | 1231085..1231387 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | PIC72_RS05905 | Protein ID | WP_000806442.1 |
| Coordinates | 1231423..1231764 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC72_RS05880 (1226348) | 1226348..1227568 | - | 1221 | WP_001773866.1 | fosmidomycin MFS transporter | - |
| PIC72_RS05885 (1227786) | 1227786..1229438 | + | 1653 | WP_001773867.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| PIC72_RS05890 (1229475) | 1229475..1229954 | - | 480 | WP_001538397.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| PIC72_RS05895 (1230158) | 1230158..1230952 | - | 795 | WP_001538398.1 | TraB/GumN family protein | - |
| PIC72_RS05900 (1231085) | 1231085..1231387 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PIC72_RS05905 (1231423) | 1231423..1231764 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| PIC72_RS05910 (1231822) | 1231822..1234326 | - | 2505 | WP_000083948.1 | copper-exporting P-type ATPase CopA | - |
| PIC72_RS05915 (1234588) | 1234588..1235520 | + | 933 | WP_001538399.1 | glutaminase A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T268370 WP_000057523.1 NZ_CP116191:1231085-1231387 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|