Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 1003348..1004042 | Replicon | chromosome |
Accession | NZ_CP116191 | ||
Organism | Escherichia coli strain DETEC-E1070 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | S1PJQ2 |
Locus tag | PIC72_RS04845 | Protein ID | WP_001263500.1 |
Coordinates | 1003644..1004042 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | PIC72_RS04840 | Protein ID | WP_000554758.1 |
Coordinates | 1003348..1003641 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC72_RS04815 (999165) | 999165..999632 | + | 468 | WP_000725261.1 | flagellar basal body-associated FliL family protein | - |
PIC72_RS04820 (999652) | 999652..1000368 | + | 717 | WP_000938731.1 | FliA/WhiG family RNA polymerase sigma factor | - |
PIC72_RS04825 (1000381) | 1000381..1001244 | + | 864 | WP_001169518.1 | flagellar motor stator protein MotA | - |
PIC72_RS04830 (1001247) | 1001247..1002170 | + | 924 | WP_001532973.1 | putative lateral flagellar export/assembly protein LafU | - |
PIC72_RS04835 (1002241) | 1002241..1003296 | + | 1056 | WP_001226168.1 | DNA polymerase IV | - |
PIC72_RS04840 (1003348) | 1003348..1003641 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
PIC72_RS04845 (1003644) | 1003644..1004042 | + | 399 | WP_001263500.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
PIC72_RS04850 (1004052) | 1004052..1004504 | + | 453 | WP_001059895.1 | GNAT family N-acetyltransferase | - |
PIC72_RS04855 (1004694) | 1004694..1005833 | + | 1140 | WP_000521561.1 | RNA ligase RtcB family protein | - |
PIC72_RS04860 (1005830) | 1005830..1006444 | + | 615 | WP_000602124.1 | peptide chain release factor H | - |
PIC72_RS04865 (1006501) | 1006501..1007958 | - | 1458 | WP_271291445.1 | cytosol nonspecific dipeptidase | - |
PIC72_RS04870 (1008219) | 1008219..1008677 | + | 459 | WP_001291991.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15413.85 Da Isoelectric Point: 8.9511
>T268368 WP_001263500.1 NZ_CP116191:1003644-1004042 [Escherichia coli]
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELEALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDAAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|