Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 113942..114368 | Replicon | plasmid pDETEC11 |
| Accession | NZ_CP116189 | ||
| Organism | Escherichia coli strain DETEC-E223 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PIC88_RS24585 | Protein ID | WP_001372321.1 |
| Coordinates | 113942..114067 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 114144..114368 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC88_RS24545 (109316) | 109316..110005 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| PIC88_RS24550 (110192) | 110192..110575 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PIC88_RS24555 (110896) | 110896..111498 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| PIC88_RS24560 (111795) | 111795..112616 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| PIC88_RS24565 (112734) | 112734..113021 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| PIC88_RS24570 (113046) | 113046..113252 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| PIC88_RS24575 (113322) | 113322..113494 | + | 173 | Protein_131 | hypothetical protein | - |
| PIC88_RS24580 (113492) | 113492..113722 | - | 231 | WP_071586998.1 | hypothetical protein | - |
| PIC88_RS24585 (113942) | 113942..114067 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PIC88_RS24590 (114009) | 114009..114158 | - | 150 | Protein_134 | plasmid maintenance protein Mok | - |
| - (114144) | 114144..114368 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (114144) | 114144..114368 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (114144) | 114144..114368 | - | 225 | NuclAT_0 | - | Antitoxin |
| - (114144) | 114144..114368 | - | 225 | NuclAT_0 | - | Antitoxin |
| PIC88_RS24595 (114180) | 114180..114368 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| PIC88_RS24600 (114337) | 114337..115099 | - | 763 | Protein_136 | plasmid SOS inhibition protein A | - |
| PIC88_RS24605 (115096) | 115096..115530 | - | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| PIC88_RS24610 (115585) | 115585..115782 | - | 198 | Protein_138 | hypothetical protein | - |
| PIC88_RS24615 (115810) | 115810..116043 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
| PIC88_RS24620 (116111) | 116111..116650 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| PIC88_RS24625 (116676) | 116676..116882 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| PIC88_RS24630 (116952) | 116952..117032 | + | 81 | Protein_142 | hypothetical protein | - |
| PIC88_RS24635 (117215) | 117215..117384 | - | 170 | Protein_143 | hypothetical protein | - |
| PIC88_RS24640 (117978) | 117978..118949 | - | 972 | WP_000817028.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | tet(A) / fosA3 / blaCTX-M-14 / aac(3)-IVa / aph(4)-Ia / sul2 / floR / blaTEM-1B / dfrA12 / aadA2 / qacE / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..154454 | 154454 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T268356 WP_001372321.1 NZ_CP116189:c114067-113942 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT268356 NZ_CP116189:c114368-114144 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|