Detailed information of TA system TA268356

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 113942..114368
• Replicon: plasmid pDETEC11
• Accession: NZ_CP116189
• Organism: Escherichia coli strain DETEC-E223

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIC88_RS24585
• Protein ID: WP_001372321.1
• Coordinates: 113942..114067 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	114144..114368 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIC88_RS24545 (109316)	109316..110005	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
PIC88_RS24550 (110192)	110192..110575	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIC88_RS24555 (110896)	110896..111498	+	603	WP_000243712.1	transglycosylase SLT domain-containing protein	-
PIC88_RS24560 (111795)	111795..112616	-	822	WP_001234426.1	DUF932 domain-containing protein	-
PIC88_RS24565 (112734)	112734..113021	-	288	WP_000107535.1	hypothetical protein	-
PIC88_RS24570 (113046)	113046..113252	-	207	WP_000547968.1	hypothetical protein	-
PIC88_RS24575 (113322)	113322..113494	+	173	Protein_131	hypothetical protein	-
PIC88_RS24580 (113492)	113492..113722	-	231	WP_071586998.1	hypothetical protein	-
PIC88_RS24585 (113942)	113942..114067	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIC88_RS24590 (114009)	114009..114158	-	150	Protein_134	plasmid maintenance protein Mok	-
- (114144)	114144..114368	-	225	NuclAT_0	-	Antitoxin
- (114144)	114144..114368	-	225	NuclAT_0	-	Antitoxin
- (114144)	114144..114368	-	225	NuclAT_0	-	Antitoxin
- (114144)	114144..114368	-	225	NuclAT_0	-	Antitoxin
PIC88_RS24595 (114180)	114180..114368	+	189	WP_001299721.1	hypothetical protein	-
PIC88_RS24600 (114337)	114337..115099	-	763	Protein_136	plasmid SOS inhibition protein A	-
PIC88_RS24605 (115096)	115096..115530	-	435	WP_000845936.1	conjugation system SOS inhibitor PsiB	-
PIC88_RS24610 (115585)	115585..115782	-	198	Protein_138	hypothetical protein	-
PIC88_RS24615 (115810)	115810..116043	-	234	WP_000005987.1	DUF905 family protein	-
PIC88_RS24620 (116111)	116111..116650	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
PIC88_RS24625 (116676)	116676..116882	-	207	WP_000275856.1	hypothetical protein	-
PIC88_RS24630 (116952)	116952..117032	+	81	Protein_142	hypothetical protein	-
PIC88_RS24635 (117215)	117215..117384	-	170	Protein_143	hypothetical protein	-
PIC88_RS24640 (117978)	117978..118949	-	972	WP_000817028.1	ParB/RepB/Spo0J family plasmid partition protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Mobilizable plasmid	tet(A) / fosA3 / blaCTX-M-14 / aac(3)-IVa / aph(4)-Ia / sul2 / floR / blaTEM-1B / dfrA12 / aadA2 / qacE / sitABCD	iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA	1..154454	154454

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T268356 WP_001372321.1 NZ_CP116189:c114067-113942 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT268356 NZ_CP116189:c114368-114144 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin