Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 73606..73860 | Replicon | plasmid pDETEC11 |
| Accession | NZ_CP116189 | ||
| Organism | Escherichia coli strain DETEC-E223 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | PIC88_RS24295 | Protein ID | WP_001312851.1 |
| Coordinates | 73711..73860 (+) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 73606..73667 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC88_RS24265 (68703) | 68703..70334 | + | 1632 | Protein_69 | conjugative transfer relaxase/helicase TraI | - |
| PIC88_RS24270 (70354) | 70354..71100 | + | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
| PIC88_RS24275 (71159) | 71159..72019 | + | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| PIC88_RS24280 (72122) | 72122..72682 | + | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| PIC88_RS24285 (72818) | 72818..73030 | + | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| PIC88_RS24290 (73276) | 73276..73350 | + | 75 | Protein_74 | endonuclease | - |
| - (73606) | 73606..73667 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (73606) | 73606..73667 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (73606) | 73606..73667 | - | 62 | NuclAT_1 | - | Antitoxin |
| - (73606) | 73606..73667 | - | 62 | NuclAT_1 | - | Antitoxin |
| PIC88_RS24295 (73711) | 73711..73860 | + | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| PIC88_RS24300 (74144) | 74144..74401 | + | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| PIC88_RS24305 (74418) | 74418..74669 | - | 252 | WP_223195197.1 | replication protein RepA | - |
| PIC88_RS24310 (74660) | 74660..74707 | + | 48 | WP_229471593.1 | hypothetical protein | - |
| PIC88_RS24315 (74700) | 74700..75182 | + | 483 | WP_001273588.1 | hypothetical protein | - |
| PIC88_RS24320 (75175) | 75175..76032 | + | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| PIC88_RS24325 (76308) | 76308..77054 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| PIC88_RS24330 (77069) | 77069..78610 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | tet(A) / fosA3 / blaCTX-M-14 / aac(3)-IVa / aph(4)-Ia / sul2 / floR / blaTEM-1B / dfrA12 / aadA2 / qacE / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..154454 | 154454 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T268353 WP_001312851.1 NZ_CP116189:73711-73860 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 62 bp
>AT268353 NZ_CP116189:c73667-73606 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|