Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 4049829..4050522 | Replicon | chromosome |
Accession | NZ_CP116188 | ||
Organism | Escherichia coli strain DETEC-E223 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | PIC88_RS19820 | Protein ID | WP_000415584.1 |
Coordinates | 4050226..4050522 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | PIC88_RS19815 | Protein ID | WP_000650107.1 |
Coordinates | 4049829..4050224 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC88_RS19805 (4045693) | 4045693..4047951 | - | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
PIC88_RS19810 (4048089) | 4048089..4049696 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
PIC88_RS19815 (4049829) | 4049829..4050224 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
PIC88_RS19820 (4050226) | 4050226..4050522 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
PIC88_RS19825 (4050727) | 4050727..4051209 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
PIC88_RS19830 (4051262) | 4051262..4051654 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
PIC88_RS19835 (4051806) | 4051806..4052465 | + | 660 | WP_001221493.1 | quorum sensing response regulator transcription factor QseB | - |
PIC88_RS19840 (4052462) | 4052462..4053811 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
PIC88_RS19845 (4053857) | 4053857..4054190 | - | 334 | Protein_3884 | DUF2645 family protein | - |
PIC88_RS19850 (4054509) | 4054509..4055090 | + | 582 | WP_033553897.1 | NADPH:quinone oxidoreductase MdaB | - |
PIC88_RS19855 (4055121) | 4055121..4055435 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T268348 WP_000415584.1 NZ_CP116188:c4050522-4050226 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT268348 WP_000650107.1 NZ_CP116188:c4050224-4049829 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|