Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 904416..905110 | Replicon | chromosome |
Accession | NZ_CP116188 | ||
Organism | Escherichia coli strain DETEC-E223 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | PIC88_RS04345 | Protein ID | WP_001263489.1 |
Coordinates | 904712..905110 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | PIC88_RS04340 | Protein ID | WP_000554758.1 |
Coordinates | 904416..904709 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC88_RS04320 (900048) | 900048..900545 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
PIC88_RS04325 (900769) | 900769..902481 | - | 1713 | Protein_844 | flagellar biosynthesis protein FlhA | - |
PIC88_RS04330 (902453) | 902453..903238 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
PIC88_RS04335 (903309) | 903309..904364 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
PIC88_RS04340 (904416) | 904416..904709 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
PIC88_RS04345 (904712) | 904712..905110 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
PIC88_RS04350 (905120) | 905120..905572 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
PIC88_RS04355 (905890) | 905890..906096 | + | 207 | Protein_850 | RtcB family protein | - |
PIC88_RS04360 (906092) | 906092..906613 | + | 522 | Protein_851 | peptide chain release factor H | - |
PIC88_RS04365 (906670) | 906670..908127 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
PIC88_RS04370 (908388) | 908388..908846 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (909442) | 909442..909522 | + | 81 | NuclAT_9 | - | - |
- (909442) | 909442..909522 | + | 81 | NuclAT_9 | - | - |
- (909442) | 909442..909522 | + | 81 | NuclAT_9 | - | - |
- (909442) | 909442..909522 | + | 81 | NuclAT_9 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T268335 WP_001263489.1 NZ_CP116188:904712-905110 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |