Detailed information of TA system TA268330

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 63460..63729
• Replicon: plasmid pDETEC56
• Accession: NZ_CP116183
• Organism: Escherichia coli strain DETEC-E480

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIB86_RS25370
• Protein ID: WP_001372321.1
• Coordinates: 63604..63729 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	63460..63525 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIB86_RS25335	59170..59697	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
PIB86_RS25340	59755..59988	+	234	WP_000006003.1	DUF905 family protein	-
PIB86_RS25345	60049..62072	+	2024	Protein_74	ParB/RepB/Spo0J family partition protein	-
PIB86_RS25350	62141..62575	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
PIB86_RS25355	62572..63334	+	763	Protein_76	plasmid SOS inhibition protein A	-
-	63303..63527	+	225	NuclAT_0	-	-
-	63303..63527	+	225	NuclAT_0	-	-
-	63303..63527	+	225	NuclAT_0	-	-
-	63303..63527	+	225	NuclAT_0	-	-
PIB86_RS25360	63312..63491	-	180	WP_001309233.1	hypothetical protein	-
-	63460..63525	-	66	-	-	Antitoxin
PIB86_RS25365	63513..63662	+	150	Protein_78	plasmid maintenance protein Mok	-
PIB86_RS25370	63604..63729	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIB86_RS25375	64048..64344	-	297	Protein_80	hypothetical protein	-
PIB86_RS25380	64644..64940	+	297	WP_001272251.1	hypothetical protein	-
PIB86_RS25385	65051..65872	+	822	WP_001234445.1	DUF932 domain-containing protein	-
PIB86_RS25390	66169..66816	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
PIB86_RS25395	67093..67476	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIB86_RS25400	67667..68353	+	687	WP_015059009.1	PAS domain-containing protein	-
PIB86_RS25405	68447..68674	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	fosA3 / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / rmtB / blaTEM-1B / blaCTX-M-55	-	1..103383	103383

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T268330 WP_001372321.1 NZ_CP116183:63604-63729 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT268330 NZ_CP116183:c63525-63460 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin