Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4763150..4763752 | Replicon | chromosome |
Accession | NZ_CP116181 | ||
Organism | Escherichia coli strain DETEC-E480 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1P416 |
Locus tag | PIB86_RS23280 | Protein ID | WP_000897302.1 |
Coordinates | 4763441..4763752 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PIB86_RS23275 | Protein ID | WP_000356397.1 |
Coordinates | 4763150..4763440 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIB86_RS23245 (4758457) | 4758457..4759386 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
PIB86_RS23250 (4759568) | 4759568..4759810 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
PIB86_RS23255 (4760100) | 4760100..4760948 | + | 849 | WP_001038650.1 | hypothetical protein | - |
PIB86_RS23260 (4760973) | 4760973..4761713 | + | 741 | WP_000608806.1 | hypothetical protein | - |
PIB86_RS23265 (4761898) | 4761898..4762116 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
PIB86_RS23270 (4762513) | 4762513..4762791 | - | 279 | WP_001296612.1 | hypothetical protein | - |
PIB86_RS23275 (4763150) | 4763150..4763440 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PIB86_RS23280 (4763441) | 4763441..4763752 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
PIB86_RS23285 (4763981) | 4763981..4764889 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
PIB86_RS23290 (4764953) | 4764953..4765894 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
PIB86_RS23295 (4765939) | 4765939..4766376 | - | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
PIB86_RS23300 (4766373) | 4766373..4767245 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
PIB86_RS23305 (4767239) | 4767239..4767547 | - | 309 | Protein_4565 | HAD-IA family hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4760100..4770312 | 10212 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T268323 WP_000897302.1 NZ_CP116181:c4763752-4763441 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|