Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 53638..53878 | Replicon | plasmid pDETEC61 |
| Accession | NZ_CP116177 | ||
| Organism | Escherichia coli strain DETEC-E601 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PIC02_RS24090 | Protein ID | WP_001372321.1 |
| Coordinates | 53753..53878 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 53638..53676 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC02_RS24060 (48831) | 48831..50789 | + | 1959 | WP_024221812.1 | ParB/RepB/Spo0J family partition protein | - |
| PIC02_RS24065 (50844) | 50844..51278 | + | 435 | WP_072834353.1 | conjugation system SOS inhibitor PsiB | - |
| PIC02_RS24070 (51275) | 51275..52061 | + | 787 | Protein_66 | plasmid SOS inhibition protein A | - |
| PIC02_RS24075 (52006) | 52006..52194 | - | 189 | WP_123002541.1 | protein sok | - |
| - (52006) | 52006..52196 | + | 191 | NuclAT_0 | - | - |
| - (52006) | 52006..52196 | + | 191 | NuclAT_0 | - | - |
| - (52006) | 52006..52196 | + | 191 | NuclAT_0 | - | - |
| - (52006) | 52006..52196 | + | 191 | NuclAT_0 | - | - |
| PIC02_RS24080 (52244) | 52244..53613 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - (53638) | 53638..53676 | + | 39 | NuclAT_1 | - | Antitoxin |
| - (53638) | 53638..53676 | + | 39 | NuclAT_1 | - | Antitoxin |
| - (53638) | 53638..53676 | + | 39 | NuclAT_1 | - | Antitoxin |
| - (53638) | 53638..53676 | + | 39 | NuclAT_1 | - | Antitoxin |
| PIC02_RS24085 (53662) | 53662..53811 | + | 150 | Protein_69 | plasmid maintenance protein Mok | - |
| PIC02_RS24090 (53753) | 53753..53878 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PIC02_RS24095 (54099) | 54099..54329 | + | 231 | WP_106121197.1 | hypothetical protein | - |
| PIC02_RS24100 (54327) | 54327..54500 | - | 174 | Protein_72 | hypothetical protein | - |
| PIC02_RS24105 (54570) | 54570..54776 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| PIC02_RS24110 (54801) | 54801..55088 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| PIC02_RS24115 (55206) | 55206..56027 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| PIC02_RS24120 (56324) | 56324..56971 | - | 648 | WP_000614935.1 | transglycosylase SLT domain-containing protein | - |
| PIC02_RS24125 (57248) | 57248..57631 | + | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PIC02_RS24130 (57822) | 57822..58508 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| PIC02_RS24135 (58602) | 58602..58829 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3')-IIa / tet(M) / qnrS1 / mph(A) / fosA3 / blaTEM-1B / blaCTX-M-55 | - | 1..93520 | 93520 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T268300 WP_001372321.1 NZ_CP116177:53753-53878 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 39 bp
>AT268300 NZ_CP116177:53638-53676 [Escherichia coli]
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
