Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
Location | 4865962..4866564 | Replicon | chromosome |
Accession | NZ_CP116176 | ||
Organism | Escherichia coli strain DETEC-E601 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9XIS6 |
Locus tag | PIC02_RS23565 | Protein ID | WP_000897305.1 |
Coordinates | 4865962..4866273 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PIC02_RS23570 | Protein ID | WP_000356397.1 |
Coordinates | 4866274..4866564 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PIC02_RS23535 (4860992) | 4860992..4861777 | + | 786 | WP_000059678.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
PIC02_RS23540 (4861876) | 4861876..4862475 | + | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
PIC02_RS23545 (4862469) | 4862469..4863341 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
PIC02_RS23550 (4863338) | 4863338..4863775 | + | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
PIC02_RS23555 (4863820) | 4863820..4864761 | + | 942 | WP_001300148.1 | fatty acid biosynthesis protein FabY | - |
PIC02_RS23560 (4864825) | 4864825..4865733 | - | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
PIC02_RS23565 (4865962) | 4865962..4866273 | + | 312 | WP_000897305.1 | hypothetical protein | Toxin |
PIC02_RS23570 (4866274) | 4866274..4866564 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
PIC02_RS23575 (4867169) | 4867169..4867387 | + | 219 | WP_001297075.1 | CopG family transcriptional regulator | - |
PIC02_RS23580 (4867606) | 4867606..4867848 | + | 243 | WP_001086388.1 | protein YiiF | - |
PIC02_RS23585 (4868178) | 4868178..4869107 | - | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
PIC02_RS23590 (4869104) | 4869104..4869739 | - | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
PIC02_RS23595 (4869736) | 4869736..4870638 | - | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T268299 WP_000897305.1 NZ_CP116176:4865962-4866273 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|