Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4074412..4075211 | Replicon | chromosome |
| Accession | NZ_CP116176 | ||
| Organism | Escherichia coli strain DETEC-E601 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | U9XVR9 |
| Locus tag | PIC02_RS19710 | Protein ID | WP_000347267.1 |
| Coordinates | 4074747..4075211 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1EB98 |
| Locus tag | PIC02_RS19705 | Protein ID | WP_001307405.1 |
| Coordinates | 4074412..4074747 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC02_RS19690 (4070197) | 4070197..4070967 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| PIC02_RS19695 (4070983) | 4070983..4072317 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PIC02_RS19700 (4072692) | 4072692..4074263 | + | 1572 | WP_001273741.1 | galactarate dehydratase | - |
| PIC02_RS19705 (4074412) | 4074412..4074747 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PIC02_RS19710 (4074747) | 4074747..4075211 | + | 465 | WP_000347267.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PIC02_RS19715 (4075266) | 4075266..4076075 | - | 810 | WP_000072193.1 | aga operon transcriptional regulator AgaR | - |
| PIC02_RS19720 (4076324) | 4076324..4077604 | + | 1281 | WP_236929999.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PIC02_RS19725 (4077627) | 4077627..4078100 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PIC02_RS19730 (4078111) | 4078111..4078890 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PIC02_RS19735 (4078880) | 4078880..4079758 | + | 879 | WP_001298758.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PIC02_RS19740 (4079776) | 4079776..4080210 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4056125..4075211 | 19086 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17807.17 Da Isoelectric Point: 9.4947
>T268297 WP_000347267.1 NZ_CP116176:4074747-4075211 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XTR4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XVC7 |