Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4597914..4598516 | Replicon | chromosome |
| Accession | NZ_CP116169 | ||
| Organism | Escherichia coli strain DETEC-P1056 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | PIC86_RS22170 | Protein ID | WP_000897305.1 |
| Coordinates | 4598205..4598516 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PIC86_RS22165 | Protein ID | WP_000356397.1 |
| Coordinates | 4597914..4598204 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC86_RS22140 (4593839) | 4593839..4594741 | + | 903 | WP_000331377.1 | formate dehydrogenase O subunit beta | - |
| PIC86_RS22145 (4594738) | 4594738..4595373 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PIC86_RS22150 (4595370) | 4595370..4596299 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| PIC86_RS22155 (4596629) | 4596629..4596871 | - | 243 | WP_001087409.1 | protein YiiF | - |
| PIC86_RS22160 (4597091) | 4597091..4597309 | - | 219 | WP_001315930.1 | CopG family transcriptional regulator | - |
| PIC86_RS22165 (4597914) | 4597914..4598204 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| PIC86_RS22170 (4598205) | 4598205..4598516 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| PIC86_RS22175 (4598745) | 4598745..4599653 | + | 909 | WP_271292777.1 | alpha/beta hydrolase | - |
| PIC86_RS22180 (4599717) | 4599717..4600658 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| PIC86_RS22185 (4600703) | 4600703..4601140 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| PIC86_RS22190 (4601137) | 4601137..4602009 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| PIC86_RS22195 (4602003) | 4602003..4602602 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
| PIC86_RS22200 (4602701) | 4602701..4603486 | - | 786 | WP_098737375.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T268278 WP_000897305.1 NZ_CP116169:c4598516-4598205 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|