Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2657737..2657957 Replicon chromosome
Accession NZ_CP116169
Organism Escherichia coli strain DETEC-P1056

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag PIC86_RS12965 Protein ID WP_000170965.1
Coordinates 2657850..2657957 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2657737..2657803 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIC86_RS12940 2653016..2654410 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
PIC86_RS12945 2654595..2654948 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
PIC86_RS12950 2654992..2655687 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
PIC86_RS12955 2655845..2656075 - 231 WP_001146442.1 putative cation transport regulator ChaB -
PIC86_RS12960 2656345..2657445 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2657737..2657803 - 67 - - Antitoxin
PIC86_RS12965 2657850..2657957 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2658270..2658333 - 64 NuclAT_35 - -
- 2658270..2658333 - 64 NuclAT_35 - -
- 2658270..2658333 - 64 NuclAT_35 - -
- 2658270..2658333 - 64 NuclAT_35 - -
- 2658270..2658333 - 64 NuclAT_38 - -
- 2658270..2658333 - 64 NuclAT_38 - -
- 2658270..2658333 - 64 NuclAT_38 - -
- 2658270..2658333 - 64 NuclAT_38 - -
- 2658270..2658333 - 64 NuclAT_41 - -
- 2658270..2658333 - 64 NuclAT_41 - -
- 2658270..2658333 - 64 NuclAT_41 - -
- 2658270..2658333 - 64 NuclAT_41 - -
- 2658270..2658333 - 64 NuclAT_44 - -
- 2658270..2658333 - 64 NuclAT_44 - -
- 2658270..2658333 - 64 NuclAT_44 - -
- 2658270..2658333 - 64 NuclAT_44 - -
- 2658270..2658333 - 64 NuclAT_47 - -
- 2658270..2658333 - 64 NuclAT_47 - -
- 2658270..2658333 - 64 NuclAT_47 - -
- 2658270..2658333 - 64 NuclAT_47 - -
- 2658270..2658333 - 64 NuclAT_50 - -
- 2658270..2658333 - 64 NuclAT_50 - -
- 2658270..2658333 - 64 NuclAT_50 - -
- 2658270..2658333 - 64 NuclAT_50 - -
- 2658271..2658333 - 63 NuclAT_52 - -
- 2658271..2658333 - 63 NuclAT_52 - -
- 2658271..2658333 - 63 NuclAT_52 - -
- 2658271..2658333 - 63 NuclAT_52 - -
- 2658271..2658333 - 63 NuclAT_55 - -
- 2658271..2658333 - 63 NuclAT_55 - -
- 2658271..2658333 - 63 NuclAT_55 - -
- 2658271..2658333 - 63 NuclAT_55 - -
- 2658271..2658333 - 63 NuclAT_58 - -
- 2658271..2658333 - 63 NuclAT_58 - -
- 2658271..2658333 - 63 NuclAT_58 - -
- 2658271..2658333 - 63 NuclAT_58 - -
- 2658272..2658333 - 62 NuclAT_17 - -
- 2658272..2658333 - 62 NuclAT_17 - -
- 2658272..2658333 - 62 NuclAT_17 - -
- 2658272..2658333 - 62 NuclAT_17 - -
- 2658272..2658333 - 62 NuclAT_20 - -
- 2658272..2658333 - 62 NuclAT_20 - -
- 2658272..2658333 - 62 NuclAT_20 - -
- 2658272..2658333 - 62 NuclAT_20 - -
- 2658272..2658333 - 62 NuclAT_23 - -
- 2658272..2658333 - 62 NuclAT_23 - -
- 2658272..2658333 - 62 NuclAT_23 - -
- 2658272..2658333 - 62 NuclAT_23 - -
- 2658272..2658333 - 62 NuclAT_26 - -
- 2658272..2658333 - 62 NuclAT_26 - -
- 2658272..2658333 - 62 NuclAT_26 - -
- 2658272..2658333 - 62 NuclAT_26 - -
- 2658272..2658333 - 62 NuclAT_29 - -
- 2658272..2658333 - 62 NuclAT_29 - -
- 2658272..2658333 - 62 NuclAT_29 - -
- 2658272..2658333 - 62 NuclAT_29 - -
- 2658272..2658333 - 62 NuclAT_32 - -
- 2658272..2658333 - 62 NuclAT_32 - -
- 2658272..2658333 - 62 NuclAT_32 - -
- 2658272..2658333 - 62 NuclAT_32 - -
PIC86_RS12970 2658386..2658493 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2658806..2658871 - 66 NuclAT_34 - -
- 2658806..2658871 - 66 NuclAT_34 - -
- 2658806..2658871 - 66 NuclAT_34 - -
- 2658806..2658871 - 66 NuclAT_34 - -
- 2658806..2658871 - 66 NuclAT_37 - -
- 2658806..2658871 - 66 NuclAT_37 - -
- 2658806..2658871 - 66 NuclAT_37 - -
- 2658806..2658871 - 66 NuclAT_37 - -
- 2658806..2658871 - 66 NuclAT_40 - -
- 2658806..2658871 - 66 NuclAT_40 - -
- 2658806..2658871 - 66 NuclAT_40 - -
- 2658806..2658871 - 66 NuclAT_40 - -
- 2658806..2658871 - 66 NuclAT_43 - -
- 2658806..2658871 - 66 NuclAT_43 - -
- 2658806..2658871 - 66 NuclAT_43 - -
- 2658806..2658871 - 66 NuclAT_43 - -
- 2658806..2658871 - 66 NuclAT_46 - -
- 2658806..2658871 - 66 NuclAT_46 - -
- 2658806..2658871 - 66 NuclAT_46 - -
- 2658806..2658871 - 66 NuclAT_46 - -
- 2658806..2658871 - 66 NuclAT_49 - -
- 2658806..2658871 - 66 NuclAT_49 - -
- 2658806..2658871 - 66 NuclAT_49 - -
- 2658806..2658871 - 66 NuclAT_49 - -
- 2658807..2658873 - 67 NuclAT_51 - -
- 2658807..2658873 - 67 NuclAT_51 - -
- 2658807..2658873 - 67 NuclAT_51 - -
- 2658807..2658873 - 67 NuclAT_51 - -
- 2658807..2658873 - 67 NuclAT_54 - -
- 2658807..2658873 - 67 NuclAT_54 - -
- 2658807..2658873 - 67 NuclAT_54 - -
- 2658807..2658873 - 67 NuclAT_54 - -
- 2658807..2658873 - 67 NuclAT_57 - -
- 2658807..2658873 - 67 NuclAT_57 - -
- 2658807..2658873 - 67 NuclAT_57 - -
- 2658807..2658873 - 67 NuclAT_57 - -
- 2658808..2658871 - 64 NuclAT_16 - -
- 2658808..2658871 - 64 NuclAT_16 - -
- 2658808..2658871 - 64 NuclAT_16 - -
- 2658808..2658871 - 64 NuclAT_16 - -
- 2658808..2658871 - 64 NuclAT_19 - -
- 2658808..2658871 - 64 NuclAT_19 - -
- 2658808..2658871 - 64 NuclAT_19 - -
- 2658808..2658871 - 64 NuclAT_19 - -
- 2658808..2658871 - 64 NuclAT_22 - -
- 2658808..2658871 - 64 NuclAT_22 - -
- 2658808..2658871 - 64 NuclAT_22 - -
- 2658808..2658871 - 64 NuclAT_22 - -
- 2658808..2658871 - 64 NuclAT_25 - -
- 2658808..2658871 - 64 NuclAT_25 - -
- 2658808..2658871 - 64 NuclAT_25 - -
- 2658808..2658871 - 64 NuclAT_25 - -
- 2658808..2658871 - 64 NuclAT_28 - -
- 2658808..2658871 - 64 NuclAT_28 - -
- 2658808..2658871 - 64 NuclAT_28 - -
- 2658808..2658871 - 64 NuclAT_28 - -
- 2658808..2658871 - 64 NuclAT_31 - -
- 2658808..2658871 - 64 NuclAT_31 - -
- 2658808..2658871 - 64 NuclAT_31 - -
- 2658808..2658871 - 64 NuclAT_31 - -
PIC86_RS12975 2658921..2659028 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
PIC86_RS12980 2659177..2660031 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
PIC86_RS12985 2660067..2660876 - 810 WP_001257044.1 invasion regulator SirB1 -
PIC86_RS12990 2660880..2661272 - 393 WP_000200392.1 invasion regulator SirB2 -
PIC86_RS12995 2661269..2662102 - 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T268271 WP_000170965.1 NZ_CP116169:2657850-2657957 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT268271 NZ_CP116169:c2657803-2657737 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References