Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2657737..2657957 | Replicon | chromosome |
| Accession | NZ_CP116169 | ||
| Organism | Escherichia coli strain DETEC-P1056 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | PIC86_RS12965 | Protein ID | WP_000170965.1 |
| Coordinates | 2657850..2657957 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2657737..2657803 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC86_RS12940 | 2653016..2654410 | - | 1395 | WP_000086201.1 | inverse autotransporter invasin YchO | - |
| PIC86_RS12945 | 2654595..2654948 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| PIC86_RS12950 | 2654992..2655687 | - | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| PIC86_RS12955 | 2655845..2656075 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| PIC86_RS12960 | 2656345..2657445 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 2657737..2657803 | - | 67 | - | - | Antitoxin |
| PIC86_RS12965 | 2657850..2657957 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2658270..2658333 | - | 64 | NuclAT_35 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_35 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_35 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_35 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_38 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_38 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_38 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_38 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_41 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_41 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_41 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_41 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_44 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_44 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_44 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_44 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_47 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_47 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_47 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_47 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_50 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_50 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_50 | - | - |
| - | 2658270..2658333 | - | 64 | NuclAT_50 | - | - |
| - | 2658271..2658333 | - | 63 | NuclAT_52 | - | - |
| - | 2658271..2658333 | - | 63 | NuclAT_52 | - | - |
| - | 2658271..2658333 | - | 63 | NuclAT_52 | - | - |
| - | 2658271..2658333 | - | 63 | NuclAT_52 | - | - |
| - | 2658271..2658333 | - | 63 | NuclAT_55 | - | - |
| - | 2658271..2658333 | - | 63 | NuclAT_55 | - | - |
| - | 2658271..2658333 | - | 63 | NuclAT_55 | - | - |
| - | 2658271..2658333 | - | 63 | NuclAT_55 | - | - |
| - | 2658271..2658333 | - | 63 | NuclAT_58 | - | - |
| - | 2658271..2658333 | - | 63 | NuclAT_58 | - | - |
| - | 2658271..2658333 | - | 63 | NuclAT_58 | - | - |
| - | 2658271..2658333 | - | 63 | NuclAT_58 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_17 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_17 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_17 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_17 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_20 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_20 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_20 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_20 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_23 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_23 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_23 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_23 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_26 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_26 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_26 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_26 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_29 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_29 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_29 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_29 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_32 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_32 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_32 | - | - |
| - | 2658272..2658333 | - | 62 | NuclAT_32 | - | - |
| PIC86_RS12970 | 2658386..2658493 | + | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2658806..2658871 | - | 66 | NuclAT_34 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_34 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_34 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_34 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_37 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_37 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_37 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_37 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_40 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_40 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_40 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_40 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_43 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_43 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_43 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_43 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_46 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_46 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_46 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_46 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_49 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_49 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_49 | - | - |
| - | 2658806..2658871 | - | 66 | NuclAT_49 | - | - |
| - | 2658807..2658873 | - | 67 | NuclAT_51 | - | - |
| - | 2658807..2658873 | - | 67 | NuclAT_51 | - | - |
| - | 2658807..2658873 | - | 67 | NuclAT_51 | - | - |
| - | 2658807..2658873 | - | 67 | NuclAT_51 | - | - |
| - | 2658807..2658873 | - | 67 | NuclAT_54 | - | - |
| - | 2658807..2658873 | - | 67 | NuclAT_54 | - | - |
| - | 2658807..2658873 | - | 67 | NuclAT_54 | - | - |
| - | 2658807..2658873 | - | 67 | NuclAT_54 | - | - |
| - | 2658807..2658873 | - | 67 | NuclAT_57 | - | - |
| - | 2658807..2658873 | - | 67 | NuclAT_57 | - | - |
| - | 2658807..2658873 | - | 67 | NuclAT_57 | - | - |
| - | 2658807..2658873 | - | 67 | NuclAT_57 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_16 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_16 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_16 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_16 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_19 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_19 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_19 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_19 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_22 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_22 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_22 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_22 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_25 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_25 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_25 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_25 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_28 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_28 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_28 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_28 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_31 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_31 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_31 | - | - |
| - | 2658808..2658871 | - | 64 | NuclAT_31 | - | - |
| PIC86_RS12975 | 2658921..2659028 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| PIC86_RS12980 | 2659177..2660031 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| PIC86_RS12985 | 2660067..2660876 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| PIC86_RS12990 | 2660880..2661272 | - | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| PIC86_RS12995 | 2661269..2662102 | - | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T268271 WP_000170965.1 NZ_CP116169:2657850-2657957 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT268271 NZ_CP116169:c2657803-2657737 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|