Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 73303..73567 | Replicon | plasmid pDETEC6 |
| Accession | NZ_CP116161 | ||
| Organism | Escherichia coli strain DETEC-P351 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | PIC26_RS24305 | Protein ID | WP_001387489.1 |
| Coordinates | 73303..73455 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 73507..73567 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIC26_RS24265 (68395) | 68395..68928 | - | 534 | WP_001221666.1 | lipocalin family protein | - |
| PIC26_RS24270 (69022) | 69022..70167 | - | 1146 | WP_075985683.1 | class C beta-lactamase CMY-146 | - |
| PIC26_RS24280 (71372) | 71372..71470 | + | 99 | Protein_84 | ethanolamine utilization protein EutE | - |
| PIC26_RS24285 (71542) | 71542..71751 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| PIC26_RS24290 (72143) | 72143..72319 | + | 177 | WP_001054897.1 | hypothetical protein | - |
| PIC26_RS24295 (72384) | 72384..72479 | - | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| PIC26_RS24300 (72980) | 72980..73231 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| PIC26_RS24305 (73303) | 73303..73455 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| - (73507) | 73507..73567 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (73507) | 73507..73567 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (73507) | 73507..73567 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (73507) | 73507..73567 | + | 61 | NuclAT_0 | - | Antitoxin |
| PIC26_RS24310 (73776) | 73776..74150 | + | 375 | WP_223349261.1 | hypothetical protein | - |
| PIC26_RS24315 (74303) | 74303..75460 | + | 1158 | Protein_91 | IS1380-like element ISEcp1 family transposase | - |
| PIC26_RS24320 (75516) | 75516..76213 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
| PIC26_RS24325 (76224) | 76224..76532 | - | 309 | WP_039023235.1 | transcription termination/antitermination NusG family protein | - |
| PIC26_RS24330 (76974) | 76974..77261 | - | 288 | WP_000074855.1 | conjugal transfer protein TraA | - |
| PIC26_RS24335 (77299) | 77299..77457 | - | 159 | Protein_95 | ash family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | blaCMY-146 | - | 1..77960 | 77960 | |
| - | inside | IScluster/Tn | blaCMY-146 | - | 51532..76213 | 24681 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T268228 WP_001387489.1 NZ_CP116161:c73455-73303 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 61 bp
>AT268228 NZ_CP116161:73507-73567 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|