Detailed information of TA system TA268224

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 73956..74377
• Replicon: plasmid pDETEC5
• Accession: NZ_CP116160
• Organism: Escherichia coli strain DETEC-P351

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIC26_RS23610
• Protein ID: WP_096937776.1
• Coordinates: 74252..74377 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	73956..74154 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIC26_RS23570 (69652)	69652..71046	+	1395	WP_001037799.1	carbohydrate porin	-
PIC26_RS23575 (71292)	71292..71396	-	105	Protein_78	thiosulfate reductase cytochrome B subunit	-
PIC26_RS23580 (71453)	71453..72146	+	694	Protein_79	IS1 family transposase	-
PIC26_RS23585 (72273)	72273..72785	+	513	WP_223350513.1	potassium channel family protein	-
PIC26_RS23590 (72870)	72870..73121	+	252	Protein_81	iron-containing alcohol dehydrogenase	-
PIC26_RS23595 (73410)	73410..73727	-	318	Protein_82	IS110 family transposase	-
PIC26_RS23600 (73882)	73882..73987	+	106	Protein_83	plasmid SOS inhibition protein A	-
- (73956)	73956..74154	+	199	NuclAT_0	-	Antitoxin
- (73956)	73956..74154	+	199	NuclAT_0	-	Antitoxin
- (73956)	73956..74154	+	199	NuclAT_0	-	Antitoxin
- (73956)	73956..74154	+	199	NuclAT_0	-	Antitoxin
PIC26_RS23605 (74161)	74161..74310	+	150	Protein_84	DUF5431 family protein	-
PIC26_RS23610 (74252)	74252..74377	+	126	WP_096937776.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIC26_RS23615 (74678)	74678..74975	-	298	Protein_86	hypothetical protein	-
PIC26_RS23620 (75045)	75045..75251	+	207	WP_000275854.1	hypothetical protein	-
PIC26_RS23625 (75276)	75276..75563	+	288	WP_000107242.1	hypothetical protein	-
PIC26_RS23630 (75682)	75682..76503	+	822	WP_001234465.1	DUF932 domain-containing protein	-
PIC26_RS23635 (76799)	76799..77371	-	573	WP_000949660.1	transglycosylase SLT domain-containing protein	-
PIC26_RS23640 (77741)	77741..78124	+	384	WP_001063020.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIC26_RS23645 (78315)	78315..78962	+	648	WP_000332520.1	conjugal transfer transcriptional regulator TraJ	-
PIC26_RS23650 (79098)	79098..79313	+	216	WP_001352842.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(A) / dfrA17 / aadA5 / qacE / sul1 / mph(A)	-	1..116501	116501

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4806.72 Da
• Isoelectric Point: 8.4890

>T268224 WP_096937776.1 NZ_CP116160:74252-74377 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGYREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 199 bp

>AT268224 NZ_CP116160:73956-74154 [Escherichia coli]
TCACACAGATTACCCGTAAACAGTCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAGGA
CAAAAGCCCCGTAGTTAATTTTTCATTAACCCACGAGGC

Structures

Antitoxin