Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3727427..3728121 | Replicon | chromosome |
Accession | NZ_CP116159 | ||
Organism | Escherichia coli strain DETEC-P351 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | PIC26_RS18000 | Protein ID | WP_001263489.1 |
Coordinates | 3727427..3727825 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | PIC26_RS18005 | Protein ID | WP_000554758.1 |
Coordinates | 3727828..3728121 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3723015) | 3723015..3723095 | - | 81 | NuclAT_11 | - | - |
- (3723015) | 3723015..3723095 | - | 81 | NuclAT_11 | - | - |
- (3723015) | 3723015..3723095 | - | 81 | NuclAT_11 | - | - |
- (3723015) | 3723015..3723095 | - | 81 | NuclAT_11 | - | - |
PIC26_RS17975 (3723691) | 3723691..3724149 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
PIC26_RS17980 (3724410) | 3724410..3725867 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
PIC26_RS17985 (3725924) | 3725924..3726445 | - | 522 | Protein_3518 | peptide chain release factor H | - |
PIC26_RS17990 (3726441) | 3726441..3726647 | - | 207 | Protein_3519 | RtcB family protein | - |
PIC26_RS17995 (3726965) | 3726965..3727417 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
PIC26_RS18000 (3727427) | 3727427..3727825 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
PIC26_RS18005 (3727828) | 3727828..3728121 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
PIC26_RS18010 (3728173) | 3728173..3729228 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
PIC26_RS18015 (3729299) | 3729299..3730084 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
PIC26_RS18020 (3730056) | 3730056..3731768 | + | 1713 | Protein_3525 | flagellar biosynthesis protein FlhA | - |
PIC26_RS18025 (3731992) | 3731992..3732489 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 3701022..3742707 | 41685 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T268217 WP_001263489.1 NZ_CP116159:c3727825-3727427 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |