Detailed information of TA system TA268196

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 79085..79511
• Replicon: plasmid pDETEC38
• Accession: NZ_CP116154
• Organism: Escherichia coli strain DETEC-P61

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIC71_RS24035
• Protein ID: WP_001372321.1
• Coordinates: 79085..79210 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	79287..79511 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIC71_RS24000 (74108)	74108..74335	-	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-
PIC71_RS24005 (74472)	74472..75143	-	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
PIC71_RS24010 (75337)	75337..75720	-	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIC71_RS24015 (76043)	76043..76645	+	603	WP_000243713.1	transglycosylase SLT domain-containing protein	-
PIC71_RS24020 (76942)	76942..77763	-	822	WP_001234445.1	DUF932 domain-containing protein	-
PIC71_RS24025 (77874)	77874..78170	-	297	WP_001272251.1	hypothetical protein	-
PIC71_RS24030 (78470)	78470..78766	+	297	Protein_97	hypothetical protein	-
PIC71_RS24035 (79085)	79085..79210	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIC71_RS24040 (79152)	79152..79301	-	150	Protein_99	plasmid maintenance protein Mok	-
PIC71_RS24045 (79323)	79323..79502	+	180	WP_001309233.1	hypothetical protein	-
- (79287)	79287..79511	-	225	NuclAT_0	-	Antitoxin
- (79287)	79287..79511	-	225	NuclAT_0	-	Antitoxin
- (79287)	79287..79511	-	225	NuclAT_0	-	Antitoxin
- (79287)	79287..79511	-	225	NuclAT_0	-	Antitoxin
PIC71_RS24050 (79480)	79480..80242	-	763	Protein_101	plasmid SOS inhibition protein A	-
PIC71_RS24055 (80239)	80239..80673	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
PIC71_RS24060 (80742)	80742..82765	-	2024	Protein_103	ParB/RepB/Spo0J family partition protein	-
PIC71_RS24065 (82826)	82826..83059	-	234	WP_000006003.1	DUF905 family protein	-
PIC71_RS24070 (83117)	83117..83644	-	528	WP_000290834.1	single-stranded DNA-binding protein	-
PIC71_RS24075 (83946)	83946..84401	+	456	Protein_106	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	ant(3'')-Ia / mph(A) / blaNDM-5 / sitABCD	iutA / iucD / iucC / iucB / iucA	1..128466	128466

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T268196 WP_001372321.1 NZ_CP116154:c79210-79085 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT268196 NZ_CP116154:c79511-79287 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin