Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yafN-yafO (relBE)/YafO-YafN
Location 3618854..3619548 Replicon chromosome
Accession NZ_CP116152
Organism Escherichia coli strain DETEC-P61

Toxin (Protein)


Gene name yafO Uniprot ID S1EXB8
Locus tag PIC71_RS17995 Protein ID WP_001263493.1
Coordinates 3618854..3619252 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name yafN Uniprot ID S1FJN6
Locus tag PIC71_RS18000 Protein ID WP_000554757.1
Coordinates 3619255..3619548 (-) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
- (3614395) 3614395..3614475 - 81 NuclAT_11 - -
- (3614395) 3614395..3614475 - 81 NuclAT_11 - -
- (3614395) 3614395..3614475 - 81 NuclAT_11 - -
- (3614395) 3614395..3614475 - 81 NuclAT_11 - -
PIC71_RS17965 (3615071) 3615071..3615529 - 459 WP_001291990.1 xanthine phosphoribosyltransferase -
PIC71_RS17970 (3615790) 3615790..3617247 + 1458 WP_001293003.1 cytosol nonspecific dipeptidase -
PIC71_RS17975 (3617304) 3617304..3617825 - 522 Protein_3515 peptide chain release factor H -
PIC71_RS17980 (3617824) 3617824..3618018 - 195 Protein_3516 RtcB family protein -
PIC71_RS17985 (3618068) 3618068..3618765 + 698 WP_095033700.1 IS1-like element IS1B family transposase -
PIC71_RS17990 (3618782) 3618782..3618844 - 63 Protein_3518 GNAT family N-acetyltransferase -
PIC71_RS17995 (3618854) 3618854..3619252 - 399 WP_001263493.1 type II toxin-antitoxin system mRNA interferase toxin YafO Toxin
PIC71_RS18000 (3619255) 3619255..3619548 - 294 WP_000554757.1 type I toxin-antitoxin system antitoxin YafN Antitoxin
PIC71_RS18005 (3619600) 3619600..3620655 - 1056 WP_001226164.1 DNA polymerase IV -
PIC71_RS18010 (3620726) 3620726..3621649 - 924 WP_001468020.1 putative lateral flagellar export/assembly protein LafU -
PIC71_RS18015 (3621652) 3621652..3622515 - 864 WP_001169518.1 flagellar motor stator protein MotA -
PIC71_RS18020 (3622528) 3622528..3623247 - 720 WP_000938740.1 FliA/WhiG family RNA polymerase sigma factor -
PIC71_RS18025 (3623267) 3623267..3623734 - 468 WP_000725257.1 flagellar basal body-associated FliL family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3569324..3620655 51331
- flank IS/Tn - - 3618388..3618765 377


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase toxin YafO

(27-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 15472.83 Da        Isoelectric Point: 8.0949

>T268190 WP_001263493.1 NZ_CP116152:c3619252-3618854 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKQARDNNQMHKIGKMAEAFRMRF

Download         Length: 399 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11233.81 Da        Isoelectric Point: 5.9050

>AT268190 WP_000554757.1 NZ_CP116152:c3619548-3619255 [Escherichia coli]
MHRILAEKSVNITELRKNPAKYFIDQPVAVLSNNRPAGYLLSASAFEALMDMLAEQEEKKPIKARFRPSAARLEEITRRA
EKYLNDMTDDDFNDFKE

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1EXB8

Antitoxin

Source ID Structure
AlphaFold DB S1FJN6

References