Detailed information of TA system TA268176

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 42840..43109
• Replicon: plasmid pDETEC60
• Accession: NZ_CP116147
• Organism: Escherichia coli strain DETEC-P622

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIB88_RS25635
• Protein ID: WP_001372321.1
• Coordinates: 42984..43109 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	42840..42905 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIB88_RS25600	38550..39077	+	528	WP_000290834.1	single-stranded DNA-binding protein	-
PIB88_RS25605	39135..39368	+	234	WP_000006003.1	DUF905 family protein	-
PIB88_RS25610	39429..41452	+	2024	Protein_49	ParB/RepB/Spo0J family partition protein	-
PIB88_RS25615	41521..41955	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
PIB88_RS25620	41952..42714	+	763	Protein_51	plasmid SOS inhibition protein A	-
-	42683..42907	+	225	NuclAT_0	-	-
-	42683..42907	+	225	NuclAT_0	-	-
-	42683..42907	+	225	NuclAT_0	-	-
-	42683..42907	+	225	NuclAT_0	-	-
PIB88_RS25625	42692..42871	-	180	WP_001309233.1	hypothetical protein	-
-	42840..42905	-	66	-	-	Antitoxin
PIB88_RS25630	42893..43042	+	150	Protein_53	plasmid maintenance protein Mok	-
PIB88_RS25635	42984..43109	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIB88_RS25640	43428..43724	-	297	Protein_55	hypothetical protein	-
PIB88_RS25645	44024..44320	+	297	WP_001272251.1	hypothetical protein	-
PIB88_RS25650	44431..45252	+	822	WP_001234445.1	DUF932 domain-containing protein	-
PIB88_RS25655	45549..46196	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
PIB88_RS25660	46473..46856	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIB88_RS25665	47047..47733	+	687	WP_015059009.1	PAS domain-containing protein	-
PIB88_RS25670	47827..48054	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	rmtB / blaTEM-1B / blaCTX-M-55	-	1..82763	82763

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T268176 WP_001372321.1 NZ_CP116147:42984-43109 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT268176 NZ_CP116147:c42905-42840 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin