Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 67570..67812 | Replicon | plasmid pDETEC55 |
| Accession | NZ_CP116146 | ||
| Organism | Escherichia coli strain DETEC-P622 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | PIB88_RS25120 | Protein ID | WP_001372321.1 |
| Coordinates | 67570..67695 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 67772..67812 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB88_RS25075 (62682) | 62682..62909 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| PIB88_RS25080 (62997) | 62997..63674 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| PIB88_RS25085 (63808) | 63808..64191 | - | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| PIB88_RS25090 (64522) | 64522..65124 | + | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
| PIB88_RS25095 (65421) | 65421..66242 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| PIB88_RS25100 (66361) | 66361..66648 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| PIB88_RS25105 (66673) | 66673..66879 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| PIB88_RS25110 (66949) | 66949..67122 | + | 174 | Protein_84 | hypothetical protein | - |
| PIB88_RS25115 (67120) | 67120..67350 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| PIB88_RS25120 (67570) | 67570..67695 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| PIB88_RS25125 (67637) | 67637..67786 | - | 150 | Protein_87 | plasmid maintenance protein Mok | - |
| - (67772) | 67772..67812 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (67772) | 67772..67812 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (67772) | 67772..67812 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (67772) | 67772..67812 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (69256) | 69256..69442 | - | 187 | NuclAT_0 | - | - |
| - (69256) | 69256..69442 | - | 187 | NuclAT_0 | - | - |
| - (69256) | 69256..69442 | - | 187 | NuclAT_0 | - | - |
| - (69256) | 69256..69442 | - | 187 | NuclAT_0 | - | - |
| PIB88_RS25135 (69411) | 69411..70173 | - | 763 | Protein_89 | plasmid SOS inhibition protein A | - |
| PIB88_RS25140 (70170) | 70170..70604 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| PIB88_RS25145 (70659) | 70659..72617 | - | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | sul1 / aadA5 / mph(A) / blaTEM-1B / aac(3)-IId | senB | 1..107932 | 107932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T268170 WP_001372321.1 NZ_CP116146:c67695-67570 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 41 bp
>AT268170 NZ_CP116146:c67812-67772 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|