Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4956488..4956709 Replicon chromosome
Accession NZ_CP116145
Organism Escherichia coli strain DETEC-P622

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag PIB88_RS24245 Protein ID WP_001531632.1
Coordinates 4956488..4956595 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4956643..4956709 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PIB88_RS24220 (4952332) 4952332..4953414 + 1083 WP_000804726.1 peptide chain release factor 1 -
PIB88_RS24225 (4953414) 4953414..4954247 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
PIB88_RS24230 (4954244) 4954244..4954636 + 393 WP_000200375.1 invasion regulator SirB2 -
PIB88_RS24235 (4954640) 4954640..4955449 + 810 WP_001257044.1 invasion regulator SirB1 -
PIB88_RS24240 (4955485) 4955485..4956339 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
PIB88_RS24245 (4956488) 4956488..4956595 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4956645) 4956645..4956708 + 64 NuclAT_12 - -
- (4956645) 4956645..4956708 + 64 NuclAT_12 - -
- (4956645) 4956645..4956708 + 64 NuclAT_12 - -
- (4956645) 4956645..4956708 + 64 NuclAT_12 - -
- (4956645) 4956645..4956708 + 64 NuclAT_13 - -
- (4956645) 4956645..4956708 + 64 NuclAT_13 - -
- (4956645) 4956645..4956708 + 64 NuclAT_13 - -
- (4956645) 4956645..4956708 + 64 NuclAT_13 - -
- (4956645) 4956645..4956708 + 64 NuclAT_14 - -
- (4956645) 4956645..4956708 + 64 NuclAT_14 - -
- (4956645) 4956645..4956708 + 64 NuclAT_14 - -
- (4956645) 4956645..4956708 + 64 NuclAT_14 - -
- (4956645) 4956645..4956708 + 64 NuclAT_15 - -
- (4956645) 4956645..4956708 + 64 NuclAT_15 - -
- (4956645) 4956645..4956708 + 64 NuclAT_15 - -
- (4956645) 4956645..4956708 + 64 NuclAT_15 - -
- (4956645) 4956645..4956708 + 64 NuclAT_16 - -
- (4956645) 4956645..4956708 + 64 NuclAT_16 - -
- (4956645) 4956645..4956708 + 64 NuclAT_16 - -
- (4956645) 4956645..4956708 + 64 NuclAT_16 - -
- (4956645) 4956645..4956708 + 64 NuclAT_17 - -
- (4956645) 4956645..4956708 + 64 NuclAT_17 - -
- (4956645) 4956645..4956708 + 64 NuclAT_17 - -
- (4956645) 4956645..4956708 + 64 NuclAT_17 - -
- (4956643) 4956643..4956709 + 67 NuclAT_10 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_10 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_10 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_10 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_5 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_5 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_5 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_5 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_6 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_6 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_6 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_6 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_7 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_7 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_7 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_7 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_8 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_8 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_8 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_8 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_9 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_9 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_9 - Antitoxin
- (4956643) 4956643..4956709 + 67 NuclAT_9 - Antitoxin
- (4956645) 4956645..4956710 + 66 NuclAT_18 - -
- (4956645) 4956645..4956710 + 66 NuclAT_18 - -
- (4956645) 4956645..4956710 + 66 NuclAT_18 - -
- (4956645) 4956645..4956710 + 66 NuclAT_18 - -
- (4956645) 4956645..4956710 + 66 NuclAT_19 - -
- (4956645) 4956645..4956710 + 66 NuclAT_19 - -
- (4956645) 4956645..4956710 + 66 NuclAT_19 - -
- (4956645) 4956645..4956710 + 66 NuclAT_19 - -
- (4956645) 4956645..4956710 + 66 NuclAT_20 - -
- (4956645) 4956645..4956710 + 66 NuclAT_20 - -
- (4956645) 4956645..4956710 + 66 NuclAT_20 - -
- (4956645) 4956645..4956710 + 66 NuclAT_20 - -
- (4956645) 4956645..4956710 + 66 NuclAT_21 - -
- (4956645) 4956645..4956710 + 66 NuclAT_21 - -
- (4956645) 4956645..4956710 + 66 NuclAT_21 - -
- (4956645) 4956645..4956710 + 66 NuclAT_21 - -
- (4956645) 4956645..4956710 + 66 NuclAT_22 - -
- (4956645) 4956645..4956710 + 66 NuclAT_22 - -
- (4956645) 4956645..4956710 + 66 NuclAT_22 - -
- (4956645) 4956645..4956710 + 66 NuclAT_22 - -
- (4956645) 4956645..4956710 + 66 NuclAT_23 - -
- (4956645) 4956645..4956710 + 66 NuclAT_23 - -
- (4956645) 4956645..4956710 + 66 NuclAT_23 - -
- (4956645) 4956645..4956710 + 66 NuclAT_23 - -
PIB88_RS24250 (4957000) 4957000..4958100 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
PIB88_RS24255 (4958370) 4958370..4958609 + 240 WP_000120702.1 putative cation transport regulator ChaB -
PIB88_RS24260 (4958758) 4958758..4959453 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
PIB88_RS24265 (4959497) 4959497..4959850 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
PIB88_RS24270 (4960035) 4960035..4961429 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T268166 WP_001531632.1 NZ_CP116145:c4956595-4956488 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT268166 NZ_CP116145:4956643-4956709 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References