Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 2859768..2860370 | Replicon | chromosome |
| Accession | NZ_CP116145 | ||
| Organism | Escherichia coli strain DETEC-P622 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | PIB88_RS13855 | Protein ID | WP_000897302.1 |
| Coordinates | 2859768..2860079 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PIB88_RS13860 | Protein ID | WP_000356397.1 |
| Coordinates | 2860080..2860370 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB88_RS13830 (2855973) | 2855973..2856281 | + | 309 | Protein_2704 | HAD-IA family hydrolase | - |
| PIB88_RS13835 (2856275) | 2856275..2857147 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| PIB88_RS13840 (2857144) | 2857144..2857581 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| PIB88_RS13845 (2857626) | 2857626..2858567 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| PIB88_RS13850 (2858631) | 2858631..2859539 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| PIB88_RS13855 (2859768) | 2859768..2860079 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| PIB88_RS13860 (2860080) | 2860080..2860370 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| PIB88_RS13865 (2860729) | 2860729..2861007 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| PIB88_RS13870 (2861404) | 2861404..2861622 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| PIB88_RS13875 (2861807) | 2861807..2862547 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| PIB88_RS13880 (2862572) | 2862572..2863420 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| PIB88_RS13885 (2863710) | 2863710..2863952 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| PIB88_RS13890 (2864134) | 2864134..2865063 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2854577..2863952 | 9375 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T268157 WP_000897302.1 NZ_CP116145:2859768-2860079 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|