Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 2044147..2044946 | Replicon | chromosome |
| Accession | NZ_CP116145 | ||
| Organism | Escherichia coli strain DETEC-P622 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | PIB88_RS09855 | Protein ID | WP_000347251.1 |
| Coordinates | 2044482..2044946 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | PIB88_RS09850 | Protein ID | WP_001296435.1 |
| Coordinates | 2044147..2044482 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PIB88_RS09835 (2039932) | 2039932..2040702 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| PIB88_RS09840 (2040718) | 2040718..2042052 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| PIB88_RS09845 (2042427) | 2042427..2043998 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
| PIB88_RS09850 (2044147) | 2044147..2044482 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| PIB88_RS09855 (2044482) | 2044482..2044946 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| PIB88_RS09860 (2045001) | 2045001..2045810 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| PIB88_RS09865 (2046059) | 2046059..2047339 | + | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| PIB88_RS09870 (2047362) | 2047362..2047835 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| PIB88_RS09875 (2047846) | 2047846..2048625 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| PIB88_RS09880 (2048615) | 2048615..2049493 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| PIB88_RS09885 (2049511) | 2049511..2049945 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T268155 WP_000347251.1 NZ_CP116145:2044482-2044946 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PPV5 |