Detailed information of TA system TA268142

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 116053..116479
• Replicon: plasmid pDETEC25
• Accession: NZ_CP116137
• Organism: Escherichia coli strain DETEC-P649

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: PIB66_RS24500
• Protein ID: WP_001372321.1
• Coordinates: 116053..116178 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	116255..116479 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
PIB66_RS24465 (111076)	111076..111303	-	228	WP_000089263.1	conjugal transfer relaxosome protein TraY	-
PIB66_RS24470 (111440)	111440..112111	-	672	WP_000283561.1	conjugal transfer transcriptional regulator TraJ	-
PIB66_RS24475 (112305)	112305..112688	-	384	WP_001354030.1	conjugal transfer relaxosome DNA-binding protein TraM	-
PIB66_RS24480 (113023)	113023..113613	+	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
PIB66_RS24485 (113910)	113910..114731	-	822	WP_001234445.1	DUF932 domain-containing protein	-
PIB66_RS24490 (114842)	114842..115138	-	297	WP_001272251.1	hypothetical protein	-
PIB66_RS24495 (115438)	115438..115734	+	297	Protein_140	hypothetical protein	-
PIB66_RS24500 (116053)	116053..116178	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
PIB66_RS24505 (116120)	116120..116269	-	150	Protein_142	plasmid maintenance protein Mok	-
PIB66_RS24510 (116291)	116291..116470	+	180	WP_001309233.1	hypothetical protein	-
- (116255)	116255..116479	-	225	NuclAT_0	-	Antitoxin
- (116255)	116255..116479	-	225	NuclAT_0	-	Antitoxin
- (116255)	116255..116479	-	225	NuclAT_0	-	Antitoxin
- (116255)	116255..116479	-	225	NuclAT_0	-	Antitoxin
PIB66_RS24515 (116448)	116448..117210	-	763	Protein_144	plasmid SOS inhibition protein A	-
PIB66_RS24520 (117207)	117207..117641	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
PIB66_RS24525 (117710)	117710..119678	-	1969	Protein_146	ParB/RepB/Spo0J family partition protein	-
PIB66_RS24530 (119739)	119739..119972	-	234	WP_000006003.1	DUF905 family protein	-
PIB66_RS24535 (120035)	120035..120574	-	540	WP_271286764.1	single-stranded DNA-binding protein	-
PIB66_RS24540 (120876)	120876..121343	+	468	Protein_149	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	tet(B) / dfrA1 / blaCTX-M-14 / qacE / cmlA1 / mph(A) / erm(B) / aac(3)-IId / blaTEM-1B	-	1..151807	151807

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T268142 WP_001372321.1 NZ_CP116137:c116178-116053 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT268142 NZ_CP116137:c116479-116255 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin